Align ATPase (characterized, see rationale)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 159 bits (401), Expect = 1e-43 Identities = 92/238 (38%), Positives = 136/238 (57%), Gaps = 11/238 (4%) Query: 15 ASAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESH 74 A+A + E V + +G QAL GVSL + RGEVV ++GPSG GK+T LR +E Sbjct: 39 AAAFSACLTFEDVRRNFGTT-QALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERP 97 Query: 75 QRGEIWIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQA 134 G + I GH ++ + ++ VG++FQ F LFPHLT+ N+ ++ P A+A Sbjct: 98 TGGRVLINGHEVAGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNVAFG---LKSLPRAEA 154 Query: 135 EATARQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPE--- 191 + A L+RV + AD+YP LSGGQQQRVA+ARAL +P ++L DEP S LD + Sbjct: 155 KREALAALKRVGLEHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRD 214 Query: 192 -MVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAP 248 M E L ++R+ G T +V TH A + DR+V+M G ++++ + + P Sbjct: 215 AMQEETLSLLRE---TGATAMVVTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQP 269 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 392 Length adjustment: 28 Effective length of query: 233 Effective length of database: 364 Effective search space: 84812 Effective search space used: 84812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory