Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_068461491.1 APY04_RS08045 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_001541235.1:WP_068461491.1 Length = 254 Score = 140 bits (353), Expect = 4e-38 Identities = 79/191 (41%), Positives = 116/191 (60%), Gaps = 5/191 (2%) Query: 18 VLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIKDRNVTWEEPKDRGI 77 VL ++L ++ GE + ++G+SGCGKSTLL IAGL S G + + + P + Sbjct: 17 VLADVDLTVERGESVAIVGASGCGKSTLLRIIAGLEPPSRGTVTVAGEEIRTPHP---AV 73 Query: 78 GMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQIQPLLKRKPSELSGG 137 GM+FQ L P +TV +N++FG + +P +E RV+ A +++ + + P ELSGG Sbjct: 74 GMIFQEPRLLPWLTVAENIAFG--ITSLPASERTARVQEALDLIGLVEHASKWPRELSGG 131 Query: 138 QRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSLKNTMIYVTHDQIEA 197 Q QRVAI RALV V L DEP S LDA R +L+ ++ L + + T++ VTHD EA Sbjct: 132 QSQRVAIARALVARPSVILLDEPFSALDAVTRVDLQRHMRALGRRMHLTLVIVTHDLEEA 191 Query: 198 LTLADRIAVMK 208 L L DR+A+M+ Sbjct: 192 LILGDRVAIMQ 202 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 254 Length adjustment: 27 Effective length of query: 334 Effective length of database: 227 Effective search space: 75818 Effective search space used: 75818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory