Align glucose transporter, ATPase component (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 90.1 bits (222), Expect = 6e-23 Identities = 68/230 (29%), Positives = 111/230 (48%), Gaps = 17/230 (7%) Query: 9 AAGATPLVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMD 68 AA + + +D+ +FG +A+ VS+++ GEVV LLG +G GK+TL+++ +G + Sbjct: 39 AAAFSACLTFEDVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPT 98 Query: 69 AGEIRVNGDKVEITNPRD---ARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVD 125 G + +NG E+ P ++ ++Q AL +L A N+ FGL Sbjct: 99 GGRVLINGH--EVAGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNV--------AFGLKS 148 Query: 126 DSAMEA--ECRKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAA 183 EA E + R+ P LSGGQ+Q VA+ARA+ +++MDEP + Sbjct: 149 LPRAEAKREALAALKRVGLEHMADEYP-HVLSGGQQQRVALARALVPRPAVMLMDEPFSG 207 Query: 184 LGPH-ETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLV 232 L M E + L+ G ++ H+ M + DR VM+ G L+ Sbjct: 208 LDVQLRDAMQEETLSLLRETGATAMVVTHNPEEAMRIGDRIVVMRAGGLI 257 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 392 Length adjustment: 27 Effective length of query: 233 Effective length of database: 365 Effective search space: 85045 Effective search space used: 85045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory