Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_068462414.1 APY04_RS10575 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >NCBI__GCF_001541235.1:WP_068462414.1 Length = 261 Score = 206 bits (525), Expect = 3e-58 Identities = 111/240 (46%), Positives = 156/240 (65%), Gaps = 3/240 (1%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKI 69 PLL ++ + A Y + L V+ V +G++VT+IG NGAGKSTL TIFG+ H G+I Sbjct: 7 PLLSLQGISASY-GSITALHNVSLDVPAGQIVTLIGANGAGKSTLMMTIFGMPRAHAGRI 65 Query: 70 TFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGA-FIRNDSLQPLKDKIFA 128 F G++I+ L ++QI RLG+ P+ +F ++VEENL MGA F + + + Sbjct: 66 MFDGQDISALPTHQIARLGLAQSPEGRRIFGRMTVEENLRMGAEFAGHREFERDLQHMTT 125 Query: 129 MFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVKQ 188 +FPRL +R QR GTLSGGE+QMLA+ +ALM P LL+LDEPS L+P++V Q+F + Sbjct: 126 IFPRLKERLHQRGGTLSGGEQQMLAIARALMSRPKLLLLDEPSLGLAPLIVKQIFRVIAD 185 Query: 189 IN-QEGTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLGAGKGH 247 +N +EG + LVEQNA AL +A R YV+ +G +SG GQELL+ P+V YL G+ H Sbjct: 186 LNAREGLTVFLVEQNAFHALRLAHRAYVMVNGVITMSGSGQELLSSPEVRAAYLEGGRHH 245 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 261 Length adjustment: 24 Effective length of query: 223 Effective length of database: 237 Effective search space: 52851 Effective search space used: 52851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory