Align LacK, component of Lactose porter (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 196 bits (498), Expect = 9e-55 Identities = 125/357 (35%), Positives = 192/357 (53%), Gaps = 25/357 (7%) Query: 8 DIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGELTIGGTVM 67 D+R+++G+ + + GV+LE+ GE V +GPSGCGK+TLLR+ AG+E + G + I G + Sbjct: 50 DVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVLINGHEV 109 Query: 68 ----NDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKILEL 123 + V P KR + ++FQ +AL+PH+T+ N+ F L+ + + E +R AA K + L Sbjct: 110 AGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNVAFGLK--SLPRAEAKREALAALKRVGL 167 Query: 124 DALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLHKEL 183 + + D P LSGGQ+QRVA+ RA+V +P V L DEP S LD +LR M+ E L +E Sbjct: 168 EHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETLSLLRET 227 Query: 184 NATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRMNFLP 243 AT + VTH+ EAM + D+IVVMR G + Q G ALY P ++FVA Sbjct: 228 GATAMVVTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQPADLFVARLF--------- 278 Query: 244 AVVIGQAEGGQVTVALKARPDTQLTVACATPP---QGGDAVTVGVRPEHFLPAGSGDTQL 300 +E +V + A + +PP Q DAVT+GVR + +G+ L Sbjct: 279 ------SEINEVAYRVGADGKIDTPIGKLSPPAGLQAHDAVTIGVRERDIRLSDNGE-GL 331 Query: 301 TAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGISAKTSFLFDA 357 + V + LG+ + +Q + + G R G ++ I + + +F A Sbjct: 332 SGRVLDAKFLGDVVRLEVGIEGFDQPLKVRVRESAGFRQGHDVRAQIDPERALVFAA 388 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 392 Length adjustment: 30 Effective length of query: 333 Effective length of database: 362 Effective search space: 120546 Effective search space used: 120546 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory