Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 191 bits (484), Expect = 4e-53 Identities = 126/356 (35%), Positives = 196/356 (55%), Gaps = 17/356 (4%) Query: 2 ASVTLRDICKSYDGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLL 61 A +T D+ +++ T + L+I+ GE V +GPSGCGK+TLLR+ AG+E T G +L Sbjct: 44 ACLTFEDVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVL 103 Query: 62 IDNQRV----NDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAV 117 I+ V + + P+ RSVG++FQ +AL+PH+T+A N+AFGLK S+ + E KR A Sbjct: 104 INGHEVAGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNVAFGLK--SLPRAEAKREALAA 161 Query: 118 AEILQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIA 177 + + L+ + + P LSGGQ+QRVA+ R +V P V L DEP S LD LR M+ E Sbjct: 162 LKRVGLEHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETL 221 Query: 178 RLHQRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSP 237 L + +T + VTH+ EAM + D+IVV+ AG + Q GQ LYH P + FVA Sbjct: 222 SLLRETGATAMVVTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQPADLFVARLFS-- 279 Query: 238 QMNFVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVMPDEADFT 297 ++N V R + A + I+ P G L+ P + + D +T+G+R + D + Sbjct: 280 EINEVAYR-VGADGK---IDTPIG-KLSPP---AGLQAHDAVTIGVRERDIRLSDNGE-G 330 Query: 298 FHGQITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHLF 353 G++ A+ LG L + +E + + V + +G A + ++ +F Sbjct: 331 LSGRVLDAKFLGDVVRLEVGIEGFDQPLKVRVRESAGFRQGHDVRAQIDPERALVF 386 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 392 Length adjustment: 30 Effective length of query: 341 Effective length of database: 362 Effective search space: 123442 Effective search space used: 123442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory