Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 157 bits (398), Expect = 4e-43 Identities = 120/358 (33%), Positives = 178/358 (49%), Gaps = 38/358 (10%) Query: 25 NLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMNDAS----PKDRDIA 80 +L+I E + +GPSGCGK+T LR+ AG+E T G + I+ + S P+ R + Sbjct: 65 SLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVLINGHEVAGPSSFVVPEKRSVG 124 Query: 81 MVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTEFLERKPADLSGGQ 140 ++FQ++AL+PH+++ N+AFGLK + + + A + +GL + P LSGGQ Sbjct: 125 LMFQDFALFPHLTIAGNVAFGLK--SLPRAEAKREALAALKRVGLEHMADEYPHVLSGGQ 182 Query: 141 RQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYVTHDQTEAM 200 +QRVA+ RA+V V LMDEP S LD +LR AM+ E + R GAT + VTH+ EAM Sbjct: 183 QQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETLSLLRETGATAMVVTHNPEEAM 242 Query: 201 TLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVTVEK 260 + DRIV+M A G + Q G + LY++PA+ FVA F E Sbjct: 243 RIGDRIVVMRA----------GGLIQQGQAEALYHQPADLFVA--------RLFSEINEV 284 Query: 261 ERLVNQDGLSLALPQGQEKILEEKGYLG-KKVTLGIRPEDIS-SDQIVHETFPNASVTAD 318 V DG + P G K+ G VT+G+R DI SD ++ Sbjct: 285 AYRVGADG-KIDTPIG--KLSPPAGLQAHDAVTIGVRERDIRLSDN-------GEGLSGR 334 Query: 319 ILVSELLGSESMLYVKFGSTEFTARVNARDS--HSPGEKVQLTFNIAKGHFFDLETEK 374 +L ++ LG L V + +V R+S G V+ + + F E +K Sbjct: 335 VLDAKFLGDVVRLEVGIEGFDQPLKVRVRESAGFRQGHDVRAQIDPERALVFAAELQK 392 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 392 Length adjustment: 30 Effective length of query: 347 Effective length of database: 362 Effective search space: 125614 Effective search space used: 125614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory