Align ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized)
to candidate WP_068461491.1 APY04_RS08045 ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF2490 (367 letters) >NCBI__GCF_001541235.1:WP_068461491.1 Length = 254 Score = 149 bits (375), Expect = 1e-40 Identities = 86/215 (40%), Positives = 128/215 (59%), Gaps = 8/215 (3%) Query: 4 LKIKNLQKGF-EGFSIIKGIDLEVNDKEFVVFVGPSGCGKSTLLRLIAGLEEVSEGTIEL 62 L I ++ K F G +++ +DL V E V VG SGCGKSTLLR+IAGLE S GT+ + Sbjct: 2 LHIGHVSKAFARGGAVLADVDLTVERGESVAIVGASGCGKSTLLRIIAGLEPPSRGTVTV 61 Query: 63 DGRDITEVTPAKRDLAMVFQTYALYPHMSVRKNMSFALDLAGVDKKLVESKVSEAARILE 122 G +I PA + M+FQ L P ++V +N++F + ++ ++V EA ++ Sbjct: 62 AGEEIRTPHPA---VGMIFQEPRLLPWLTVAENIAFGITSLPASERT--ARVQEALDLIG 116 Query: 123 LGPLLERKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQMRLELARLHKE 182 L + P++LSGGQ QRVAI RA+V P + L DEP S LDA RV ++ + L + Sbjct: 117 LVEHASKWPRELSGGQSQRVAIARALVARPSVILLDEPFSALDAVTRVDLQRHMRALGRR 176 Query: 183 LQATMIYVTHDQVEAMTLADKVVVL--NSGRIEQV 215 + T++ VTHD EA+ L D+V ++ N GRI ++ Sbjct: 177 MHLTLVIVTHDLEEALILGDRVAIMQPNPGRIAKI 211 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 254 Length adjustment: 27 Effective length of query: 340 Effective length of database: 227 Effective search space: 77180 Effective search space used: 77180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory