Align high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)
to candidate WP_083509610.1 APY04_RS08095 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003736 (237 letters) >NCBI__GCF_001541235.1:WP_083509610.1 Length = 270 Score = 190 bits (483), Expect = 2e-53 Identities = 112/241 (46%), Positives = 150/241 (62%), Gaps = 9/241 (3%) Query: 5 MLSFDKVSAHYGK-IQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLCGDPRA-----T 58 +L + ++A Y + ALH VSL +++GE+ ++GANGAGK+T L + A T Sbjct: 7 LLVVNNLAAVYNHAVSALHGVSLRVSRGEVRAILGANGAGKSTTLKAISNVLSAVRGQIT 66 Query: 59 SGRIVFDDKDITDWQTAKIMREAVAIVPEGRRVFSRMTVEENLAMGGFF--AERDQFQER 116 +G I FD D+ + + ++R + V EGR VF +TVEENL GG + R + Sbjct: 67 AGSIAFDGLDVAKTKPSDLIRAGLVPVLEGRHVFKSLTVEENLNTGGLGRGSSRAEIASD 126 Query: 117 IKWVYELFPRLHERRIQRAGTMSGGEQQMLAIGRALMSNPRLLLLDEPSLGLAPIIIQQI 176 ++ VY LFP L +R AG SGGEQQM+A+GRALM+ PRLL+LDEPS+GLAPI++Q I Sbjct: 127 LERVYTLFPSLTRKRKIAAGLTSGGEQQMVAVGRALMARPRLLVLDEPSMGLAPIVVQSI 186 Query: 177 FDTIEQL-REQGMTIFLVEQNANQALKLADRGYVLENGHVVLSDTGDALLANEAVRSAYL 235 FDT+ +L RE+G+TI L EQNA AL+ A VLENG VL D L VR YL Sbjct: 187 FDTLRKLNREEGLTILLAEQNAAIALRYASSATVLENGATVLEGPADELRNRADVREFYL 246 Query: 236 G 236 G Sbjct: 247 G 247 Lambda K H 0.321 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 270 Length adjustment: 24 Effective length of query: 213 Effective length of database: 246 Effective search space: 52398 Effective search space used: 52398 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory