Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate WP_245281768.1 APY04_RS00535 long-chain fatty acid--CoA ligase
Query= BRENDA::A7KUK6 (562 letters) >NCBI__GCF_001541235.1:WP_245281768.1 Length = 575 Score = 201 bits (510), Expect = 8e-56 Identities = 154/503 (30%), Positives = 245/503 (48%), Gaps = 43/503 (8%) Query: 68 RKGDVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVT---- 123 RKG + LF PNS + + L AGGT+ NP YTV EL Q+++S + ++T Sbjct: 85 RKGTKVGLFLPNSPTFIIYFFAVLKAGGTVVNFNPLYTVAELTHQVEDSDTELMITLDLK 144 Query: 124 ----------QASVLPVAREAAKKVGMPEDRIILIGDQRDPDARVKHFTSVRN------- 166 Q+ L A A +P + L R + + V N Sbjct: 145 VLFDKVEALLQSGCLARALVAPFPSLLPATKAALFRLFRSRELARPLSSPVANRVTLEGE 204 Query: 167 -ISGATRYRKQKITPAKDVAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWN 225 ++GA + I P DVA L Y+ GTTG PKG M++H N+ N++Q ++ Sbjct: 205 ALAGAATMQPVAIDPENDVAVLQYTGGTTGTPKGAMLTHANVYINVQQVAATAPDL---- 260 Query: 226 GGPDGKGDRVLAFLPFYHIYGLTCLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSY 285 + +RVL LPF+H++ LT ++ + K +I+M +F ++ + + + Sbjct: 261 ---EPGVERVLGVLPFFHVFALTVVMNLGIAKAAEIIIMPRFALDDALKLIDRTKPTIMP 317 Query: 286 IVPPVVLLLGKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSP 345 VP + + HP + +DLSSL+ SG A L E+ + + + +GYGLSE SP Sbjct: 318 GVPTLFNAIMNHPKIASFDLSSLKFCLSGGAALPIEVKQRFEAITGCKVVEGYGLSEASP 377 Query: 346 TTHSQRWEDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGY 405 + A GS+G +P + +++ + + EV GE GE+ +KGP V GY Sbjct: 378 VVACNPIDGPARA-GSIG--IP-LVGTTISLRDLNNPELEVPLGEKGEICVKGPQVMKGY 433 Query: 406 HENPEATKGCLSEDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDN 465 ++ PE T + + + +TGDV DA G FYI DR+K+LI GF V P +E L ++ Sbjct: 434 YKRPEDTAAQMVGE-YLRTGDVACMDADGFFYIKDRIKDLIISSGFNVYPRRVEEALYEH 492 Query: 466 DAIDDVAVIGIESETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLR 525 A+ +V VIGI + G E P A V K+ ++ T A +++ L +++ S L Sbjct: 493 PAVAEVTVIGIRDKKRG-EAPKAFV--RLKTDTTVT-----VAELMEHLQTRI-SRIELP 543 Query: 526 GGVHFVDEIPKNPSGKILRRILK 548 + F E+PK GK+ ++ LK Sbjct: 544 AEIEFRAELPKTLIGKLSKKELK 566 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 683 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 562 Length of database: 575 Length adjustment: 36 Effective length of query: 526 Effective length of database: 539 Effective search space: 283514 Effective search space used: 283514 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory