Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_083509610.1 APY04_RS08095 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_001541235.1:WP_083509610.1 Length = 270 Score = 186 bits (473), Expect = 3e-52 Identities = 109/249 (43%), Positives = 158/249 (63%), Gaps = 10/249 (4%) Query: 1 MAEKSNKVLLQVKGLKVAYG-GIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTL 59 M+E+S+ LL V L Y + A+ GV V GE+ +++G+NGAGK+TT+KAI+ L Sbjct: 1 MSERSD--LLVVNNLAAVYNHAVSALHGVSLRVSRGEVRAILGANGAGKSTTLKAISNVL 58 Query: 60 S-----MNDGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIR-K 113 S + G+I + G + DL++ GLV V EGR VF +T+ ENL G R Sbjct: 59 SAVRGQITAGSIAFDGLDVAKTKPSDLIRAGLVPVLEGRHVFKSLTVEENLNTGGLGRGS 118 Query: 114 DKAGILADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGL 173 +A I +D+E+++T+FP L ++ AG SGGEQQM+A+GRALM++P++L+LDEPSMGL Sbjct: 119 SRAEIASDLERVYTLFPSLTRKRKIAAGLTSGGEQQMVAVGRALMARPRLLVLDEPSMGL 178 Query: 174 SPIMVDKIFEVVRDV-YALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLND 232 +PI+V IF+ +R + G+TI+L EQNA+ AL A V+E+G + GP +L N Sbjct: 179 APIVVQSIFDTLRKLNREEGLTILLAEQNAAIALRYASSATVLENGATVLEGPADELRNR 238 Query: 233 PKVRAAYLG 241 VR YLG Sbjct: 239 ADVREFYLG 247 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 270 Length adjustment: 24 Effective length of query: 218 Effective length of database: 246 Effective search space: 53628 Effective search space used: 53628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory