Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 178 bits (451), Expect = 3e-49 Identities = 99/274 (36%), Positives = 160/274 (58%), Gaps = 4/274 (1%) Query: 29 LSKEQILEKTGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLID 88 L+ E + G + + SL I+ GE+ ++G SG GK+T++R+ + PT G+VLI+ Sbjct: 46 LTFEDVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVLIN 105 Query: 89 GVDIAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDA 148 G ++A S + E ++ + ++FQ FAL PH+T+ N AFG++ + E + +AL A Sbjct: 106 GHEVAGPSSFVVPE--KRSVGLMFQDFALFPHLTIAGNVAFGLK--SLPRAEAKREALAA 161 Query: 149 LRQVGLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELV 208 L++VGLE+ A YP LSGG +QRV LARAL P ++LMDE FS LD +R MQ+E + Sbjct: 162 LKRVGLEHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETL 221 Query: 209 KLQAKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGV 268 L + T + ++H+ +EAMRIGDRI +M+ G ++Q G + + + PA+ +V F + Sbjct: 222 SLLRETGATAMVVTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQPADLFVARLFSEI 281 Query: 269 DISQVFSAKDIARRSPVGLIRKTPGFGPRSALKL 302 + D +P+G + G A+ + Sbjct: 282 NEVAYRVGADGKIDTPIGKLSPPAGLQAHDAVTI 315 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 392 Length adjustment: 31 Effective length of query: 369 Effective length of database: 361 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory