Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_068461491.1 APY04_RS08045 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_001541235.1:WP_068461491.1 Length = 254 Score = 155 bits (393), Expect = 8e-43 Identities = 82/191 (42%), Positives = 119/191 (62%), Gaps = 5/191 (2%) Query: 18 VIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTIRIDGEDATNIPPAKRGL 77 V+ +DLT+E GE VG SGCGKSTLLR+IAGLE + GT+ + GE+ PA + Sbjct: 17 VLADVDLTVERGESVAIVGASGCGKSTLLRIIAGLEPPSRGTVTVAGEEIRTPHPA---V 73 Query: 78 AMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAALNLTDYLDRRPGQLSGG 137 M+FQ L P ++V +NIAF + +PA E+ R+ A + L ++ + P +LSGG Sbjct: 74 GMIFQEPRLLPWLTVAENIAFGI--TSLPASERTARVQEALDLIGLVEHASKWPRELSGG 131 Query: 138 QRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELHKRLATTMIYVTHDQVEA 197 Q QRVAI RA+V P+ L DEP S LDA RV ++ + L +R+ T++ VTHD EA Sbjct: 132 QSQRVAIARALVARPSVILLDEPFSALDAVTRVDLQRHMRALGRRMHLTLVIVTHDLEEA 191 Query: 198 MTMADKIVVLQ 208 + + D++ ++Q Sbjct: 192 LILGDRVAIMQ 202 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 254 Length adjustment: 26 Effective length of query: 308 Effective length of database: 228 Effective search space: 70224 Effective search space used: 70224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory