Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= uniprot:A8LLL2 (373 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 179 bits (454), Expect = 1e-49 Identities = 121/357 (33%), Positives = 193/357 (54%), Gaps = 18/357 (5%) Query: 2 ADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLE 61 A L V + +G + L+ ++L+I +GE++ +GPSGCGK+TLLR+ AG+E+ TGG + Sbjct: 44 ACLTFEDVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVL 103 Query: 62 IDGTVV----NDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAA 117 I+G V + V P +R + ++FQ +AL+PH+T+ N++F LK +++A+ +A AA Sbjct: 104 INGHEVAGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNVAFGLKSLPRAEAKREAL--AA 161 Query: 118 AEKLQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIA 177 +++ L D P LSGGQ+QRVA+ R++V P V L DEP S LD LR A + E Sbjct: 162 LKRVGLEHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETL 221 Query: 178 QLKEAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGS 237 L + MV VTH+ EAM + RIVV+ GG+ Q G LY +P + FVA+ Sbjct: 222 SLLRETGATAMV-VTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQPADLFVARLFS- 279 Query: 238 PKMNLLPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAPGGDY 297 ++N + ++ GA ++ G + P AV +GVR D + + G+ Sbjct: 280 -EINEVAYRV---GADGKIDTPIGKLS----PPAGLQAHDAVTIGVRERD-IRLSDNGEG 330 Query: 298 VFEGKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIHKDLKGQVTRLTAEPAKVHVF 354 + G+V + LG+V L + P +++ +G R +P + VF Sbjct: 331 L-SGRVLDAKFLGDVVRLEVGIEGFDQPLKVRVRESAGFRQGHDVRAQIDPERALVF 386 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 392 Length adjustment: 30 Effective length of query: 343 Effective length of database: 362 Effective search space: 124166 Effective search space used: 124166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory