Align TreV, component of Trehalose porter (characterized)
to candidate WP_083509566.1 APY04_RS07015 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_001541235.1:WP_083509566.1 Length = 392 Score = 160 bits (406), Expect = 4e-44 Identities = 85/233 (36%), Positives = 139/233 (59%), Gaps = 6/233 (2%) Query: 7 DIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIADGADI 66 D+ + +G + G++ +I+ GE +LGPSG GK+TLL+I AGIE+ G+++ +G ++ Sbjct: 50 DVRRNFGTTQALAGVSLEIDRGEVVCLLGPSGCGKTTLLRIAAGIERPTGGRVLINGHEV 109 Query: 67 TDKP----PEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGI 122 PEKR+V ++FQ++AL+P++++ N+AF LK + + E A K +G+ Sbjct: 110 AGPSSFVVPEKRSVGLMFQDFALFPHLTIAGNVAFGLK--SLPRAEAKREALAALKRVGL 167 Query: 123 SEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKEL 182 + D+ +SGGQQQRVALARA+V P+ L+DEP S LD ++R + E + +E Sbjct: 168 EHMADEYPHVLSGGQQQRVALARALVPRPAVMLMDEPFSGLDVQLRDAMQEETLSLLRET 227 Query: 183 KGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGE 235 T + VTH+ +EA+ + DRI ++ G Q + LY P +VA+ E Sbjct: 228 GATAMVVTHNPEEAMRIGDRIVVMRAGGLIQQGQAEALYHQPADLFVARLFSE 280 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 392 Length adjustment: 29 Effective length of query: 295 Effective length of database: 363 Effective search space: 107085 Effective search space used: 107085 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory