Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_068461491.1 APY04_RS08045 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_001541235.1:WP_068461491.1 Length = 254 Score = 160 bits (406), Expect = 3e-44 Identities = 96/214 (44%), Positives = 130/214 (60%), Gaps = 7/214 (3%) Query: 4 IHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRI 63 +H ++K +A G VL +DL + GE V ++G SGCGKST+LR+IAGLE S GT+ + Sbjct: 2 LHIGHVSKAFARGGAVLADVDLTVERGESVAIVGASGCGKSTLLRIIAGLEPPSRGTVTV 61 Query: 64 GGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLN 123 G ++ V M+FQ L P ++V +NIAFG+ L PA+E RV+E L+ Sbjct: 62 AG---EEIRTPHPAVGMIFQEPRLLPWLTVAENIAFGITSL--PASERTARVQEALDLIG 116 Query: 124 LEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQR 183 L + PR +SGGQ QR AIARA++ PSV L DEP S LDA R L+ ++ L +R Sbjct: 117 LVEHASKWPRELSGGQSQRVAIARALVARPSVILLDEPFSALDAVTRVDLQRHMRALGRR 176 Query: 184 LRTTTVYVTHDQLEAMTLADRVILMQ--DGRIVQ 215 + T V VTHD EA+ L DRV +MQ GRI + Sbjct: 177 MHLTLVIVTHDLEEALILGDRVAIMQPNPGRIAK 210 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 254 Length adjustment: 28 Effective length of query: 378 Effective length of database: 226 Effective search space: 85428 Effective search space used: 85428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory