GapMind for catabolism of small carbon sources

 

Protein WP_066918546.1 in Steroidobacter denitrificans DSM 18526

Annotation: NCBI__GCF_001579945.1:WP_066918546.1

Length: 380 amino acids

Source: GCF_001579945.1 in NCBI

Candidate for 101 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi PotG aka B0855, component of Putrescine porter (characterized) 58% 95% 415.2 MalK aka PF1933, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) 44% 255.8
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 90% 241.9 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 90% 241.9 PotG aka B0855, component of Putrescine porter 58% 415.2
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 45% 83% 230.7 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism malK med ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 41% 89% 229.6 PotG aka B0855, component of Putrescine porter 58% 415.2
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 45% 78% 228 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism thuK med ABC transporter (characterized, see rationale) 41% 83% 228 PotG aka B0855, component of Putrescine porter 58% 415.2
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 44% 75% 227.6 PotG aka B0855, component of Putrescine porter 58% 415.2
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 83% 226.1 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 43% 83% 226.1 PotG aka B0855, component of Putrescine porter 58% 415.2
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 42% 80% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
lactose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism aglK med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism aglK' med Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 40% 86% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 81% 223.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-mannitol catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 41% 78% 219.5 PotG aka B0855, component of Putrescine porter 58% 415.2
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 41% 78% 219.5 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 88% 216.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
lactose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism gtsD med GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 41% 76% 214.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 43% 71% 213 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 43% 71% 208 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism malK med MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 41% 72% 203.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 41% 85% 176 PotG aka B0855, component of Putrescine porter 58% 415.2
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 43% 76% 154.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 99% 254.6 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 95% 231.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 89% 228.4 PotG aka B0855, component of Putrescine porter 58% 415.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 94% 217.2 PotG aka B0855, component of Putrescine porter 58% 415.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 37% 94% 215.7 PotG aka B0855, component of Putrescine porter 58% 415.2
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 44% 68% 213.4 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 84% 212.2 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 86% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 90% 206.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 37% 89% 205.3 PotG aka B0855, component of Putrescine porter 58% 415.2
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 39% 72% 202.6 PotG aka B0855, component of Putrescine porter 58% 415.2
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 68% 195.7 PotG aka B0855, component of Putrescine porter 58% 415.2
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 68% 195.7 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 68% 195.7 PotG aka B0855, component of Putrescine porter 58% 415.2
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 40% 68% 195.7 PotG aka B0855, component of Putrescine porter 58% 415.2
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 42% 60% 184.9 PotG aka B0855, component of Putrescine porter 58% 415.2
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 33% 88% 177.2 PotG aka B0855, component of Putrescine porter 58% 415.2
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 97% 176.4 PotG aka B0855, component of Putrescine porter 58% 415.2
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 40% 84% 167.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 99% 164.1 PotG aka B0855, component of Putrescine porter 58% 415.2
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 34% 92% 161.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 34% 92% 161.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-glutamate catabolism gltL lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 34% 92% 161.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 35% 92% 159.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 94% 157.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 94% 157.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 94% 157.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 94% 157.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 94% 157.5 PotG aka B0855, component of Putrescine porter 58% 415.2
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 90% 155.2 PotG aka B0855, component of Putrescine porter 58% 415.2
L-arginine catabolism artP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 98% 154.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 98% 154.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 98% 154.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 35% 71% 150.2 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 36% 98% 147.5 PotG aka B0855, component of Putrescine porter 58% 415.2
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 36% 99% 144.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 36% 99% 144.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 35% 97% 144.4 PotG aka B0855, component of Putrescine porter 58% 415.2
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 35% 97% 144.4 PotG aka B0855, component of Putrescine porter 58% 415.2
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 33% 96% 141.4 PotG aka B0855, component of Putrescine porter 58% 415.2
L-alanine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-serine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-threonine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 31% 96% 134.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 31% 100% 131.7 PotG aka B0855, component of Putrescine porter 58% 415.2
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 35% 82% 131.3 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 34% 74% 120.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 32% 98% 120.2 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 32% 70% 118.6 PotG aka B0855, component of Putrescine porter 58% 415.2
D-alanine catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 95% 109.8 PotG aka B0855, component of Putrescine porter 58% 415.2
L-proline catabolism AZOBR_RS08245 lo Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 30% 95% 109.8 PotG aka B0855, component of Putrescine porter 58% 415.2
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 89% 100.9 PotG aka B0855, component of Putrescine porter 58% 415.2

Sequence Analysis Tools

View WP_066918546.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MASNARPQPVLPPWSDPQSEPYVRIEHVTKKFGEFPAVNDVSLKIYKKELFCLLGGSGSG
KTTLLRMLAGFEEPTSGRIFIDGVDMTGVPPYERPVNMMFQSYALFPHMSVEQNVAFGLK
QDRIPKAQITERVADMLNLVKLSQFARRKPHQLSGGQRQRVALARSLVKRPKLLLLDEPL
GALDKKLREHTQFELVNLQEKLGVTFVVVTHDQEEAMTLSTRIGVMNQGEIVQVGSPKDI
YEYPNSKFVAEFVGNVNMFQGRLIEDEPDHVRIDSPEIGATIYVDHGVSSAPDAVVWAAI
RPEKMLIGIEKPVQQDNVARGVVKEIAYLGDMSVYLVQLDSGKIVRVTQPNVYRHADDLV
TWDQTVYLSWHASSAVVLGK

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory