Align Histidine transport system permease protein HisM (characterized)
to candidate WP_068168721.1 HTA01S_RS07505 ABC transporter permease subunit
Query= SwissProt::P0A2I7 (235 letters) >NCBI__GCF_001592305.1:WP_068168721.1 Length = 226 Score = 112 bits (280), Expect = 6e-30 Identities = 72/211 (34%), Positives = 112/211 (53%), Gaps = 3/211 (1%) Query: 17 GYRFTGVAITLWLLISSVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLL 76 G G +T+ L +SS+V+G L ++LA G +S +R + L T + RG P ++ +L Sbjct: 9 GQLLQGAWVTVQLALSSLVVGLALGLVLAAGSLSGRTLLRRAVRLCTGLLRGIPEFLIVL 68 Query: 77 VFYSGMYTLEIVKGTDLLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAA 136 V Y G+ L L A S V AL++ AY +E+F G+ ++P G+IEAA Sbjct: 69 VCYFGLSNLI---NNHLDGAVEISPFAAGVFALSIVFAAYASEVFRGSFAAIPRGQIEAA 125 Query: 137 RAYGFSSFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVPDLLKIARDINSAT 196 +A+G ++ + + + LP A RIALP+ N +L T+L + DLLK + AT Sbjct: 126 QAFGLTATQTFFAVRLPQAWRIALPSLGNLWQSLLKDTSLVSVVGLEDLLKKSNMAAQAT 185 Query: 197 YQPFTAFGIAAVLYLLISYVLISLFRRAERR 227 +QPF F AA +Y + + +F ERR Sbjct: 186 HQPFLFFLAAATVYFVFLHASQPVFAWLERR 216 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 226 Length adjustment: 23 Effective length of query: 212 Effective length of database: 203 Effective search space: 43036 Effective search space used: 43036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory