Align AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized)
to candidate WP_068169050.1 HTA01S_RS08125 ABC transporter permease subunit
Query= TCDB::O50183 (232 letters) >NCBI__GCF_001592305.1:WP_068169050.1 Length = 238 Score = 239 bits (611), Expect = 3e-68 Identities = 123/232 (53%), Positives = 164/232 (70%), Gaps = 7/232 (3%) Query: 5 FSVIWD--SLPLYFDGLLVTLKLLSISLLIGLLLAVPLALMRVSKQPLVNFPAWLYTYVI 62 F++I+ +L LY+ GL+ T++LL +SL+ G LL +PL LMRVS+ V+ P WL+TYV+ Sbjct: 4 FAIIFQPQNLQLYWTGLIATMELLGVSLIAGALLTLPLTLMRVSRNRWVSSPIWLFTYVV 63 Query: 63 RGTPMLVQLFLIYYGLAQFDAVRE--SALWP--WLSNASFCACLAFAINTSAYTAEILAG 118 RGTP+L+Q++ IYYG+AQ + V+ WP W + FCA LAF +NT AYT E+LAG Sbjct: 64 RGTPLLIQVYFIYYGIAQLEWVQGLWDTHWPFTWFKDPFFCAVLAFTLNTCAYTVEMLAG 123 Query: 119 SLKATPHGEIEAAKAMGMSRLKMYRRILLPSALRRALPQYSNEVIMMLQTTSLASIV-TL 177 ++K TP GEIEAA+A G + M R++LPSA+RR LP YSNEV+MML TSLAS+V L Sbjct: 124 AIKETPAGEIEAAQAAGFGKWNMMFRLILPSAMRRTLPGYSNEVVMMLHATSLASVVPAL 183 Query: 178 VDITGAARTVYSQYYLPFEAFITAGLFYLCLTFILVRLFKLAERRWLAYLAP 229 D+T AA +Y YYL F+ FI + Y LTF LV +F+L ERR+LAYL P Sbjct: 184 YDLTNAAYAIYKTYYLAFQPFIFVAVLYFMLTFALVYVFRLLERRFLAYLRP 235 Lambda K H 0.330 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 238 Length adjustment: 23 Effective length of query: 209 Effective length of database: 215 Effective search space: 44935 Effective search space used: 44935 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory