Align Ornithine cyclodeaminase; OCD; EC 4.3.1.12 (characterized)
to candidate WP_068166973.1 HTA01S_RS02545 ornithine cyclodeaminase family protein
Query= SwissProt::P09773 (354 letters) >NCBI__GCF_001592305.1:WP_068166973.1 Length = 329 Score = 105 bits (262), Expect = 2e-27 Identities = 84/264 (31%), Positives = 123/264 (46%), Gaps = 27/264 (10%) Query: 56 SHSRDGVIELMPTSDGTLYGFKYVNGHPKNTKSGRQTVTAFGVLSDVDSGYPLLLSEMTI 115 SHS I M S G +G P SG TV F D S + + + ++ Sbjct: 57 SHSAANEIISMKASSGGFPNNPIDHGVP----SGMGTVLLF----DARSCALICVMDGSL 108 Query: 116 LTALRTAATSAIAAKYLARKDSRTMALIGNGAQSEFQALAFKALIGVDRIRLYDIDPEAT 175 LT LRT A A++ K LARK+ +T+ IG G Q+ Q A ++ ++ I +D PE Sbjct: 109 LTGLRTGAAGAVSVKALARKNVKTVTSIGTGKQARMQIRAIHHVMKIEEIHAWDHHPENL 168 Query: 176 ARCSRNLQ-RFGFQIEACTSAEQAVEGADIITTATADKHNATILSDNMIGPGVHINGVGG 234 AR +++ FG + S + AVE A I+ T T K ++ I PG HI +G Sbjct: 169 ARYKADIEGEFGIPVVMARSMQAAVEQAHILITTTRGK--GALVEAAWIQPGTHIVAMGT 226 Query: 235 DCPGKTEMHRDILLRSDIFVEFPPQTRIEGEIQQLAPDHPV-----------TELWRVMT 283 D GK E +I + I + Q +GE HP+ EL ++ Sbjct: 227 DTYGKQEFEPEIFRGAKIVNDSIAQCIEKGETW-----HPLNRNIIRREDIHAELGEILL 281 Query: 284 GQDVGRKSDKQITLFDSVGFAIED 307 G+ GR++D +IT+FDS G AI+D Sbjct: 282 GKKPGRETDHEITIFDSTGMAIQD 305 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 329 Length adjustment: 29 Effective length of query: 325 Effective length of database: 300 Effective search space: 97500 Effective search space used: 97500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory