Align FAA hydrolase family protein (characterized, see rationale)
to candidate WP_068167541.1 HTA01S_RS05345 fumarylacetoacetate hydrolase family protein
Query= uniprot:A0A2E7P912 (281 letters) >NCBI__GCF_001592305.1:WP_068167541.1 Length = 284 Score = 447 bits (1149), Expect = e-130 Identities = 214/285 (75%), Positives = 244/285 (85%), Gaps = 5/285 (1%) Query: 1 MKLLRYGPVGQEKPGVLDQSGKIRDLSAYIKDVNGAVLDDASLDKIRKLDLESLPAVEGS 60 MKLLRYG GQEKPGVLD G++RDLS I DV GA L SL ++R LD++SLP V G+ Sbjct: 1 MKLLRYGSPGQEKPGVLDAQGRVRDLSGEIADVAGAALLPESLARLRSLDIDSLPLVAGT 60 Query: 61 P----RIGACVGNIGKFICIGLNYADHAAESNLPIPAEPVVFNKWTSAVVGPNDDVKIPR 116 P R+GACVG +GKFICIGLNY+DHAAES +P+P EPVVFNKWTSA+VGP+D V+IPR Sbjct: 61 PQQDLRLGACVGQVGKFICIGLNYSDHAAESGMPVPPEPVVFNKWTSAIVGPDDAVEIPR 120 Query: 117 GSKKTDWEVELGVVIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIERGGTWDKGKGCD 176 GS KTDWEVELGVVIG+GG YI+E DA+SHVAGYCVVNDVSEREYQ++R GTWDKGKGCD Sbjct: 121 GSVKTDWEVELGVVIGQGGRYIEEADALSHVAGYCVVNDVSEREYQLDRSGTWDKGKGCD 180 Query: 177 TFGPIGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPG 236 TFGP GPWLVT DEV DPQ L MWLEVDGKRYQ+G+T+TM++GVA ++SYLSRFMSLQPG Sbjct: 181 TFGPTGPWLVTADEVPDPQALKMWLEVDGKRYQDGSTATMVYGVAFLISYLSRFMSLQPG 240 Query: 237 DVISTGTPPGVGMGVKPEAVYLRAGQTMRLGIDGLGEQQQKTIDA 281 D+ISTGTPPGVG+G KP VYLRAGQTMRLGIDGLG Q Q T+ A Sbjct: 241 DIISTGTPPGVGLGQKP-PVYLRAGQTMRLGIDGLGIQTQTTVQA 284 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 284 Length adjustment: 26 Effective length of query: 255 Effective length of database: 258 Effective search space: 65790 Effective search space used: 65790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory