Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate WP_084236167.1 HTA01S_RS16340 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:Q888H2 (294 letters) >NCBI__GCF_001592305.1:WP_084236167.1 Length = 334 Score = 150 bits (378), Expect = 5e-41 Identities = 104/288 (36%), Positives = 143/288 (49%), Gaps = 14/288 (4%) Query: 14 GESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADSRG-GWIAGMEN 72 GE +WSVREQ LYWVDI +LHR D SW + ++ +A + G I + Sbjct: 54 GEGLLWSVREQVLYWVDILACQLHRLDPVSGDHSSWTFAEEISALAERANAPGLIVTLRR 113 Query: 73 GLYHLQPCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTMLMDMAAGAVVGALY 132 G P D L E G RFNDG+CD QGRFWAG+ MD A A GALY Sbjct: 114 GFALFDPATDHE--PRYLCQPEPELPGNRFNDGKCDAQGRFWAGS--MDFACEAPTGALY 169 Query: 133 RYSA-GQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFDYDTDSGTPHDRR 191 RY GQ T + +V NG ++ D + L + + +D D+ +GT +++ Sbjct: 170 RYDPDGQCTRHDE--GFVVTNGPTWALDAGRLCLYFNDTLSGSTYRYDCDSTTGTLSNKQ 227 Query: 192 LFVDMNNYLGRPDGAAIDADGCYWIC--GNDAGLVHRFTPNGKLDRSLVVPVKKPAMCAF 249 L+ G PDG DA G WI G+ H +L R +++PV + C F Sbjct: 228 LWNRFEPGDGLPDGLTTDALGRVWIAHWGSACVTCHNPVTAEELGR-VMLPVSQVTTCTF 286 Query: 250 GGPNLDTLFVTSIRPG---GDLSDQPLAGGVFALRPGVKGLEEPVFQG 294 GGP+L TLF+++ R G L+ +PLAGG+FA+ GL +F G Sbjct: 287 GGPDLRTLFISTARTGLTPEQLAAEPLAGGLFAVSVDAPGLPANLFGG 334 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 334 Length adjustment: 27 Effective length of query: 267 Effective length of database: 307 Effective search space: 81969 Effective search space used: 81969 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory