Align tartronate semialdehyde reductase 2 (characterized)
to candidate WP_279338484.1 HTA01S_RS01495 NAD(P)-dependent oxidoreductase
Query= ecocyc::G6278-MONOMER (292 letters) >NCBI__GCF_001592305.1:WP_279338484.1 Length = 301 Score = 214 bits (546), Expect = 1e-60 Identities = 124/291 (42%), Positives = 180/291 (61%), Gaps = 5/291 (1%) Query: 3 LGFIGLGIMGTPMAINLARAGHQLHVTTIGP-VADELLSLGAVSVETARQVTEASDIIFI 61 + +G+G+MG P+A L AG+Q+ P A+ L GA +T Q +D++ Sbjct: 15 IAVLGIGMMGWPIARRLCVAGYQVSAWNRSPDKAERLRPFGAQVCDTPAQAVAQADLVIT 74 Query: 62 MVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSG 121 ++ D VE+VLF + G T+ G +VDMSSI P + + A ++ +G +LDAPVSG Sbjct: 75 LLEDGKVVEDVLFRQ-GTTEGLRPGALVVDMSSIQPRQARDHAARLAAIGVHHLDAPVSG 133 Query: 122 GEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNIE 181 G +GA + TL+IM GG A FER +P+FE LG+ T VG +G GQ K+ANQ+IV + I Sbjct: 134 GTVGAEQATLAIMAGGKPADFERARPVFEHLGRP-THVGPHGSGQLAKLANQMIVGITIG 192 Query: 182 AVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLNL 241 AV+EALL K GAD +VRQA+ GGFA SRIL+VHG+RM++R F I++ KD+ Sbjct: 193 AVAEALLLCEKGGADMAKVRQAITGGFADSRILQVHGQRMVERDFAKRGAISVQLKDMRN 252 Query: 242 ALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKLA 292 A+ +A+ + P TA ++LF A +G + LDHSAL +EL + + +A Sbjct: 253 AMATAREIGFEAPITALFEQLFAQAADHGLADLDHSALF--VELASRNGMA 301 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 301 Length adjustment: 26 Effective length of query: 266 Effective length of database: 275 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory