Align Histidine transport system permease protein HisM (characterized)
to candidate WP_068169050.1 HTA01S_RS08125 ABC transporter permease subunit
Query= SwissProt::P0AEU3 (238 letters) >NCBI__GCF_001592305.1:WP_068169050.1 Length = 238 Score = 185 bits (470), Expect = 6e-52 Identities = 102/221 (46%), Positives = 143/221 (64%), Gaps = 8/221 (3%) Query: 20 FTGVAITLWLLILSVVIGGVLALFLAIGRVSSNKYIQFPIWLFTYIFRGTPLYVQLLVFY 79 +TG+ T+ LL +S++ G +L L L + RVS N+++ PIWLFTY+ RGTPL +Q+ Y Sbjct: 17 WTGLIATMELLGVSLIAGALLTLPLTLMRVSRNRWVSSPIWLFTYVVRGTPLLIQVYFIY 76 Query: 80 SGMYTLEIVKG---TEFLNAFFRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAA 136 G+ LE V+G T + +F+ C VLA TLNTCAYT E+ AGAI+ P GEIEAA Sbjct: 77 YGIAQLEWVQGLWDTHWPFTWFKDPFFCAVLAFTLNTCAYTVEMLAGAIKETPAGEIEAA 136 Query: 137 RAYGFSTFKMYRCIILPSALRIALPAYSNEVILMLHSTALAFTATVP---DLLKIARDIN 193 +A GF + M +ILPSA+R LP YSNEV++MLH+T+LA + VP DL A I Sbjct: 137 QAAGFGKWNMMFRLILPSAMRRTLPGYSNEVVMMLHATSLA--SVVPALYDLTNAAYAIY 194 Query: 194 AATYQPFTAFGIAAVLYLIISYVLISLFRRAEKRWLQHVKP 234 Y F F AVLY ++++ L+ +FR E+R+L +++P Sbjct: 195 KTYYLAFQPFIFVAVLYFMLTFALVYVFRLLERRFLAYLRP 235 Lambda K H 0.330 0.142 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 238 Length adjustment: 23 Effective length of query: 215 Effective length of database: 215 Effective search space: 46225 Effective search space used: 46225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory