Align Histidine transport system permease protein HisQ (characterized)
to candidate WP_084235932.1 HTA01S_RS07500 ABC transporter permease subunit
Query= SwissProt::P0A2I9 (228 letters) >NCBI__GCF_001592305.1:WP_084235932.1 Length = 233 Score = 97.4 bits (241), Expect = 2e-25 Identities = 68/217 (31%), Positives = 104/217 (47%), Gaps = 3/217 (1%) Query: 9 ILQGAIVTLELALSSVVLAVLIGLVGAGAKLSQNRVTGLIFEGYTTLIRGVPDLVLMLLI 68 + +G ++TL+L SV+LA + L A A S + GY+ RG P LV + ++ Sbjct: 20 VWEGLVITLQLLCGSVLLAFALALPLALAATSGKAWPARLARGYSAAFRGTPLLVQLFIL 79 Query: 69 FYGLQIALNVVTDSLGIDQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVPKGHIEAAT 128 +YG+ V S ++ D G++ L AY E R +AVP G EAA Sbjct: 80 YYGVS-QFEAVRHSPAWWVLE-DAFYCGLLALSLNLAAYMAEDLRAGILAVPLGEKEAAL 137 Query: 129 AFGFTHGQTFRRIMFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKATQLAGKSTW 188 A G + Q +R I+ PA R A P +GN LKATALVS + + D+ + +++ Sbjct: 138 AMGMSPFQCYRWIVLPAAWRIATPALGNEVIAQLKATALVSTITVLDLTGVARRLSNASY 197 Query: 189 EPFYFAVVCGLIYLVFTTVSNGVLLLLERRYSVGVKR 225 VV G++Y T V + +ERR+ +R Sbjct: 198 TTDAL-VVAGVVYAAITLVVVLAVRRIERRFGPAGRR 233 Lambda K H 0.328 0.144 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 233 Length adjustment: 23 Effective length of query: 205 Effective length of database: 210 Effective search space: 43050 Effective search space used: 43050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory