Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_068167375.1 HTA01S_RS04365 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_001592305.1:WP_068167375.1 Length = 358 Score = 168 bits (426), Expect = 2e-46 Identities = 102/306 (33%), Positives = 172/306 (56%), Gaps = 26/306 (8%) Query: 19 YSLISV--LVSVGVLNLFYVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAYA 76 YSL+ + L + V+ +++ L + I ++ +GL L+ GF+G FSLGHA F+ +GAY Sbjct: 25 YSLLGLFLLAAPWVIEEYWLAQLTFVLIYAVVGLGLMLLAGFTGLFSLGHAAFLGVGAYT 84 Query: 77 AAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFII 136 A++ + + A+ LLS AV ++VG+P LR+KG YL +ATL I+ + Sbjct: 85 QAVMVNAGLPFPL---ALACAGLLSAAVGMVVGLPALRVKGIYLGMATLAFGFIVEEALA 141 Query: 137 NGGSLTNGAAGI-LGIPNFTTWQM-----VYFFVVITTI----ATLNFLRSPIGRSTLSV 186 S+T G +G+ + P W++ YF ++ T+ A +N +RS GR+ +++ Sbjct: 142 RWESVTGGNSGLSVNPPALFGWELESTNEFYFLCLVVTVGATLAIVNLMRSSTGRAFVAI 201 Query: 187 REDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIV 246 R+ EI+A+S+G++ + K ++F A A I G+L A I + P+ ++ I SI++L++V Sbjct: 202 RDSEISAQSMGIHLARYKTLSFALSAALAGIGGALYAHKIQFLSPEQFSIIQSIDLLLMV 261 Query: 247 VFGGLGSITGAIVSAIVLGILNMLLQ-----------DVASVRMIIYALALVLVMIFRPG 295 V GGLGSI GA + AI L ++ L+ A ++ +Y L L+ ++F P Sbjct: 262 VIGGLGSIHGAFLGAIFLIVMPQLIALGKDYLPDAIGQAAGLQGTVYGLVLIGFVLFEPM 321 Query: 296 GLLGTW 301 GL G W Sbjct: 322 GLYGRW 327 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 358 Length adjustment: 28 Effective length of query: 290 Effective length of database: 330 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory