Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_068172833.1 HTA01S_RS14255 thiolase family protein
Query= BRENDA::B7XEI5 (396 letters) >NCBI__GCF_001592305.1:WP_068172833.1 Length = 410 Score = 286 bits (731), Expect = 1e-81 Identities = 175/408 (42%), Positives = 231/408 (56%), Gaps = 18/408 (4%) Query: 2 SVAVKGVFIVGAKRTPFGTFGGVFRNTSATELQTIAATAALKEANVAPDQVDTVTVGQVM 61 S +++ RTP + G S T++ A A ++ A VA VD+V G M Sbjct: 5 SARFSNAWLLDGVRTPLVDYCGALGAISPTDMGIKVARAVIQRAGVAASDVDSVITGS-M 63 Query: 62 SGTQTDGIYTPRHAALKAGIPQEKPVLGINRLCGSGFQSVINGAQDILTGAAKVSLAGGV 121 + D PRH L AG+P P + R+CG+GF+ A I G A+++L G Sbjct: 64 AQADFDAFVLPRHIGLYAGVPMAVPAILAQRICGTGFELFRQAADQIALGYAELALVVGT 123 Query: 122 ENMSQAPFAVRGVRFGTTLGLNYAFEDTLWAGLTDSYCGLPMGMTAEKLGAQYSITRDEV 181 E+M++ P A R G LG F+D L L D+ + M TAE L QY I+R +V Sbjct: 124 ESMTRNPIAAYTHRSGFKLGAPVEFKDFLVEALNDTAGPITMIETAENLAKQYGISRADV 183 Query: 182 DNFALQSQQRWKTSNDAGVFKAEIEPVT-------------LTIKRKQVSVAVDEHPRPQ 228 D FA QS +R + G EI PV + + RK VA D HPRP Sbjct: 184 DTFAAQSFERALKAQADGFHAGEIVPVVNEDFALDGYHTRGIRLPRKVDQVAHDTHPRP- 242 Query: 229 TTLEGLKKLPPVFKKEGLVTAGTASGISDGAGAIVLASEEAAK--GLKPLARLVGWSVVG 286 + +E L KL PV+ G+ TAG +S + DGA ++AS+ K GLKPLARLVG + VG Sbjct: 243 SPVETLAKLRPVYAG-GVQTAGNSSALVDGAVGALVASDAYVKRNGLKPLARLVGAAAVG 301 Query: 287 VDPSIMGVGPVPAIQNLLKATNMTLNDVDLIEINEAFCAQTLACAKALKLDMNKLNVNGG 346 V P IMG+GP PAI+ LL+ +TL+D+ L EINEA AQTLA + L LD +KLNVNGG Sbjct: 302 VPPEIMGIGPAPAIRALLERCELTLDDIGLFEINEAQGAQTLAVERELGLDRDKLNVNGG 361 Query: 347 ATALGHPLGASGSRITAHLVHELRRRGLKRAIGSACIGGGQGIALMVE 394 A ALGHPL A+G R+T L EL+RRGL+ I SAC+GGGQG+AL++E Sbjct: 362 AIALGHPLAATGVRLTVTLARELKRRGLRYGISSACVGGGQGMALLIE 409 Lambda K H 0.317 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 410 Length adjustment: 31 Effective length of query: 365 Effective length of database: 379 Effective search space: 138335 Effective search space used: 138335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory