Align High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized)
to candidate WP_068167375.1 HTA01S_RS04365 branched-chain amino acid ABC transporter permease
Query= SwissProt::P22729 (425 letters) >NCBI__GCF_001592305.1:WP_068167375.1 Length = 358 Score = 169 bits (429), Expect = 9e-47 Identities = 111/324 (34%), Positives = 171/324 (52%), Gaps = 38/324 (11%) Query: 93 LVALLVLAVAWPFMVSRGTVDIATLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAYT 152 L+ L +LA W ++ + T +IY ++GLGL ++ G +GL LG+ F +GAYT Sbjct: 27 LLGLFLLAAPW--VIEEYWLAQLTFVLIYAVVGLGLMLLAGFTGLFSLGHAAFLGVGAYT 84 Query: 153 FALLNHYYGLGFWTCLPIAGLMAAAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNN 212 A++ + GL F L AGL++AA G ++G P LR++G YL + TL FG IV L Sbjct: 85 QAVMVNA-GLPFPLALACAGLLSAAVGMVVGLPALRVKGIYLGMATLAFGFIVEEALARW 143 Query: 213 TEITGGPNGISQIPKPTLFGLEFSRTAREGGWDTFSNFFGLKYDPSDRVIFLYLVALLLV 272 +TGG +G+S P P LFG E T Y + L++ Sbjct: 144 ESVTGGNSGLSVNP-PALFGWELESTNE-----------------------FYFLCLVVT 179 Query: 273 VLSLFVINRLLRMPLGRAWEALREDEIACRSLGLSPRRIKLTAFTISAAFAGFAGTLFAA 332 V + I L+R GRA+ A+R+ EI+ +S+G+ R K +F +SAA AG G L+A Sbjct: 180 VGATLAIVNLMRSSTGRAFVAIRDSEISAQSMGIHLARYKTLSFALSAALAGIGGALYAH 239 Query: 333 RQGFVSPESFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDFNEYSMLMLG- 391 + F+SPE F+ +S +L +VV+GG+GS L AI L+V +L+ +Y +G Sbjct: 240 KIQFLSPEQFSIIQSIDLLLMVVIGGLGSIHGAFLGAIFLIVMPQLIALGKDYLPDAIGQ 299 Query: 392 ---------GLMVL-MMIWRPQGL 405 GL+++ +++ P GL Sbjct: 300 AAGLQGTVYGLVLIGFVLFEPMGL 323 Lambda K H 0.330 0.145 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 358 Length adjustment: 31 Effective length of query: 394 Effective length of database: 327 Effective search space: 128838 Effective search space used: 128838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory