Align 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; EC 4.1.2.53; 2-dehydro-3-deoxyrhamnonate aldolase (uncharacterized)
to candidate WP_068169741.1 HTA01S_RS09100 4-hydroxy-2-oxoheptanedioate aldolase
Query= curated2:B5R262 (267 letters) >NCBI__GCF_001592305.1:WP_068169741.1 Length = 269 Score = 277 bits (708), Expect = 2e-79 Identities = 141/261 (54%), Positives = 186/261 (71%), Gaps = 1/261 (0%) Query: 7 NPFKEGLRKGDTQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTVQDLYHQLQAIAP 66 N F++ L+ G QIG W+ + +AE A G+DWLL+DGEHAPN + + QL+A+AP Sbjct: 6 NTFRDALKAGQPQIGCWVGFASPDVAEALAGCGFDWLLLDGEHAPNDPRTVLDQLRAVAP 65 Query: 67 Y-ASQPVIRPIEGSKALIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPLGQRGVGAS 125 Y A+ PV+R +E + AL+KQ LD+GAQTLLIPMVDTAEQA +V A RY P G RG+GA+ Sbjct: 66 YSATHPVVRAVEANVALVKQYLDVGAQTLLIPMVDTAEQAALMVKAMRYAPEGIRGMGAA 125 Query: 126 VARAARWGRIDNYMAQANESLCLLVQVESKVALENLDAILEVEGIDGVFIGPADLSASLG 185 +ARA+RW ++D+Y+ QAN +CLLVQ E+ A++NL AI E EG+DGVF GPADLSAS+G Sbjct: 126 LARASRWNQVDDYLNQANGQMCLLVQAETVEAIKNLQAIAETEGVDGVFFGPADLSASMG 185 Query: 186 YPDNAGHPEVQRIIESCIYRIRAAGKAAGFLAVDPAMAQKCLAWGANFVAVGVDTMLYTE 245 + GHP+VQ++I I +RAAGKAAG LA DPA+AQ+ L GA FVAVG+DT L + Sbjct: 186 HRGQPGHPDVQKVILDGIATVRAAGKAAGILATDPALAQQYLDAGALFVAVGLDTTLLVK 245 Query: 246 ALDSRLAMFKSVQSVSTAKRS 266 A + F + S + A S Sbjct: 246 AASGLVQRFSAGASKAPASPS 266 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 269 Length adjustment: 25 Effective length of query: 242 Effective length of database: 244 Effective search space: 59048 Effective search space used: 59048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory