Align Rhamnulokinase (EC 2.7.1.5) (characterized)
to candidate WP_068170318.1 HTA01S_RS10190 FGGY family carbohydrate kinase
Query= reanno::HerbieS:HSERO_RS22200 (459 letters) >NCBI__GCF_001592305.1:WP_068170318.1 Length = 486 Score = 263 bits (673), Expect = 7e-75 Identities = 174/443 (39%), Positives = 229/443 (51%), Gaps = 33/443 (7%) Query: 3 VFDIGKTNIKLTLVDEHGQELAVRRRPNQPRQDGPYPHHDVAAIEAWLLENLAALARQWR 62 V D+GK+N KL L + G +A R R N Q Y + A++AW+ E++ L R Sbjct: 9 VLDVGKSNAKLVLFNAEGDVIARRVRANHSVQTPHYLALGLDALQAWVQESVPTLPEHAR 68 Query: 63 IRAIVPVTHGATAALVDEAGLVLPVADYEHDFALPPAHRPYESLRPPFAQSASPLLGMGL 122 I I THGA V+ +GL LP DYE D Y S F + +PLL +GL Sbjct: 69 IGRIGITTHGAAFCAVNGSGLALPAIDYEWD-GYGELRADYASRIDGFETTGTPLLPLGL 127 Query: 123 NLGRQLYWQSQRYPDAFARARYLLMYPQYWSWRLSGVAAGELSSLGCHTDLWQPGQQCYS 182 N G QL+W Q P+A+ L YPQYW+W +GVAA E+SSLGCHT LWQP + ++ Sbjct: 128 NAGLQLFWLQQTQPEAWQGIEAWLPYPQYWAWWFTGVAAYEVSSLGCHTHLWQPARNRFA 187 Query: 183 SLLAQCNWTPLMPPLRAAWERLGPLRPELAQRTGLPADCAVLCGVHDSNASLLRYLRGTG 242 + PPLR A+E +GP++P LA+R GLPA C V G+HDSNA L R+L Sbjct: 188 PWAVREGLVERFPPLRLAYEAIGPVQPALAERLGLPAGCVVYAGLHDSNACLARHLHALP 247 Query: 243 GGPRIVLSSGTW--LIAAALDGCVSGLREEADMLANVNVLGAPVACMRFMGGREFAQIAG 300 G V+S+GTW ++ + G L + L N ++ G PV RFMGGREFA + Sbjct: 248 GAS--VVSTGTWCVVMTPGVTGREQALDPAREQLFNQSIEGRPVPTARFMGGREFAHLCH 305 Query: 301 DDLPCSAEQ--LQALIDAQVFALPCFSECGGPFA--GRRGSIV------GQAPQ--QPGS 348 P A + L +++A LP GP A G+ G IV G APQ Sbjct: 306 GADPALATESALHEVLEAGWLVLP--GHDAGPAANFGQAGEIVRGDQPMGSAPQVVPLHL 363 Query: 349 RYALATLYCALMTAYCLDAL------------DAPGEIVVEGSFTANPHFAALLAALVS- 395 R ALA +YCA+MT L L DA +++EG NP +AA L+AL++ Sbjct: 364 RPALAAMYCAMMTTRILFDLLPLALRGNPQRSDALSVVILEGPLADNPAYAAALSALLAP 423 Query: 396 RTVYRSSD-ASGTTLGGWLLDRW 417 V RS D GT G WL RW Sbjct: 424 LAVVRSQDEVEGTARGAWLSTRW 446 Lambda K H 0.322 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 691 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 486 Length adjustment: 33 Effective length of query: 426 Effective length of database: 453 Effective search space: 192978 Effective search space used: 192978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory