Align RhaS, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate WP_245638054.1 HTA01S_RS10180 rhamnose ABC transporter substrate-binding protein
Query= TCDB::Q7BSH5 (331 letters) >NCBI__GCF_001592305.1:WP_245638054.1 Length = 300 Score = 205 bits (522), Expect = 1e-57 Identities = 110/296 (37%), Positives = 180/296 (60%), Gaps = 5/296 (1%) Query: 34 KSLGNGFFDAANKGAQEAAKELGGVEVIYTGPTSTTAEGQIEVINSLIAQGVDAIAVSAN 93 K + N + +G EAA+E+G + GPT+ A Q+ I+ LIA+ ++A+ ++AN Sbjct: 6 KQVNNPYHAMLGQGVMEAAREMGA-QARMLGPTTAQALAQVPFIDQLIAERLNAVILAAN 64 Query: 94 DPDALVPALKKATQRGIKVISWDSGVAPEGRILQLNPSSNELIGKMCLTLAKDHLEGGKG 153 + AL+P +++ G K+++ D+ +A + R L +N +S E +G+ + L ++ +G Sbjct: 65 EAVALLPKVRELIAVGTKIVAVDADLATDARDLFINQASQEGVGRAQMQLMAKLMDW-QG 123 Query: 154 DFAILSATTTSTNQNIWIDQMKKQLKD--FPGLNLVTTVYGDDLSDKSYREAEGLLKSNP 211 +FAILSAT T++NQN WI M ++L+ + + + +YG+D + KS + LL+ NP Sbjct: 124 EFAILSATVTASNQNAWIYWMLQELRRPAYKNMKMTKVLYGNDDAVKSREQCIALLQ-NP 182 Query: 212 NVKVIVAPTTVGVLAASKVVEDKGLVGKVYVTGLGLPSEMAGAIKSGATKEFAIWNPIDL 271 N++ I++PTTVG+LA+++ V GKV+VTGLG P++M +K G + F +WNP+DL Sbjct: 183 NLRGIISPTTVGILASAEYVASSPFKGKVHVTGLGTPNQMRPFVKDGTVRAFQLWNPVDL 242 Query: 272 GYSATQIAYRLVKGETDGKPGSEINAGRMGKIKVGDNGEAAMADPFVYNASNIDQF 327 GY A A L KG+ G G +AGR+G VG GE + P ++ SNID+F Sbjct: 243 GYLAAYAAASLTKGQISGTKGDSFSAGRLGDYIVGSKGEVILGVPTTFDVSNIDRF 298 Lambda K H 0.313 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 300 Length adjustment: 27 Effective length of query: 304 Effective length of database: 273 Effective search space: 82992 Effective search space used: 82992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory