Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate WP_068168204.1 HTA01S_RS06375 betaine-aldehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >NCBI__GCF_001592305.1:WP_068168204.1 Length = 485 Score = 260 bits (665), Expect = 6e-74 Identities = 170/475 (35%), Positives = 249/475 (52%), Gaps = 11/475 (2%) Query: 7 LKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTWSKVAVP 66 L ++ING+ V +E V NPAT V +T++D++ A + A F WS ++ Sbjct: 6 LFSFINGQTVNGGGQVFESV-NPATGRAYAVVHEATQDDVNRAVEAAGAGFALWSAMSAT 64 Query: 67 RRARILFNFQQLLSQHKEELAHLITIENGKNTKEALG-EVGRGIENVEFAAGAPSLMMGD 125 R RIL +L + ELA L + GK +EAL +V G + +E+ AGA + + G Sbjct: 65 ERGRILRRAADILRERNHELAALEVRDCGKPIQEALVVDVMSGADCIEYFAGAAATLTGQ 124 Query: 126 SLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTPLLT 185 + A + P+GV GI +N+P+ + CW A+A GN I KPSE TP Sbjct: 125 QYP--LKNAFAYTRKEPLGVCVGIGAWNYPIQIACWKSAPALAAGNAMIFKPSELTPATA 182 Query: 186 EKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVYKKGSENLK 245 KL E++ +AG+P GVFNVV G V + HP++ +S GS P G+ V + + LK Sbjct: 183 VKLAEVYLEAGVPPGVFNVVQGRGAVGAMLAAHPDVAKVSVTGSVPTGKRVMETAAGTLK 242 Query: 246 RVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEFMAKLQ 305 RV G K+ +V +DA+LE V + F + GE C C V V+ GIA F+A+L+ Sbjct: 243 RVTMELGGKSPLLVFDDADLEQAVAAAMMGNFYTQGEVCTNCTRVFVQRGIAPRFLARLK 302 Query: 306 EKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDDG---Y 362 E+ +++G+ D +G +I E + R + YI G EGA LVC G E V+ +G Sbjct: 303 ERTLLLRVGDPTDPDTEIGALISEAHTARVMDYIASGQAEGATLVCGG-ERVAVEGLGDQ 361 Query: 363 FVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSNAI 422 FV PTIF + +M I ++EIF PVLS++ EAI AN+S F+ A +FT++ Sbjct: 362 FVAPTIFADCRDDMRIVREEIFGPVLSMLTFDTEAEAIARANQSRFSLAAGVFTTDLQRG 421 Query: 423 RYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRKKVV 477 I AG+ IN P+ PF G S G+ N ++D YT+ K V Sbjct: 422 HRVAAQIRAGICWINNYNITPIE-MPFGGVGESGIGS--ENSMAALDHYTQLKTV 473 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 485 Length adjustment: 34 Effective length of query: 453 Effective length of database: 451 Effective search space: 204303 Effective search space used: 204303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory