Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate WP_068170917.1 HTA01S_RS11035 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >NCBI__GCF_001592305.1:WP_068170917.1 Length = 393 Score = 166 bits (421), Expect = 9e-46 Identities = 115/382 (30%), Positives = 187/382 (48%), Gaps = 12/382 (3%) Query: 52 NDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI-KGYGC 110 N L + A+R VRE + E+AP E + +FP K+G +GV G ++ + YG Sbjct: 8 NFQLGEDIDALRDAVREFAQAEIAPRAAEIDKSDQFPMDCWRKMGELGVLGITVPEQYGG 67 Query: 111 PGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVA 170 + A+ +A EI+R AS HS+L + I G++AQK KYLP L V Sbjct: 68 ANMGYLAHMVAMEEISRASASVGLSYGAHSNLCVNQINRNGNDAQKAKYLPKLISGEHVG 127 Query: 171 CWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTT---TNQI 227 A++EP GSD + A G + +NG K WI N AD L+++A++ + Sbjct: 128 ALAMSEPGAGSDVISMKLKAEDKGGYYLLNGNKMWITNGPDADTLVVYAKSEPEMGARGV 187 Query: 228 NGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVN-SFQDTSKVLAV 286 F+++K PG + +K+G+R G+++ QNV VP ++ L G+N + L Sbjct: 188 TAFLIEKGMPGFSIAQKLDKLGMRGSHTGELVFQNVEVPAQNILGGLNMGAKVLMSGLDY 247 Query: 287 SRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWR 346 R ++ P+GI + D Y+ +RKQFG + FQL Q K+ M +QA + Sbjct: 248 ERAVLTGGPLGIMQSVMDNVIPYIHDRKQFGQSIGEFQLIQGKVADMYTVLQAARSFAYT 307 Query: 347 LCKLYE------TGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCD 400 + K + Q+ AS+ W + KA A G ++ GGNG + ++ + + + D Sbjct: 308 VAKNLDLLGTEHVRQVRKDCASV-ILWTAEKATWMAGEGVQIYGGNGYINEYPLGRLWRD 366 Query: 401 LEPIYTYEGTYDINTLVTGREV 422 + GT +I ++ GRE+ Sbjct: 367 AKLYEIGAGTSEIRRMLIGREL 388 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 393 Length adjustment: 31 Effective length of query: 405 Effective length of database: 362 Effective search space: 146610 Effective search space used: 146610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory