Align Catechol 1,2-dioxygenase; EC 1.13.11.1 (characterized)
to candidate WP_068175025.1 HTA01S_RS20720 protocatechuate 3,4-dioxygenase
Query= SwissProt::P86029 (303 letters) >NCBI__GCF_001592305.1:WP_068175025.1 Length = 193 Score = 67.4 bits (163), Expect = 2e-16 Identities = 53/162 (32%), Positives = 67/162 (41%), Gaps = 30/162 (18%) Query: 93 TSSAILGPFY---LP---DSPVYPNGGSIVQKAIPTDVKCFVRGKVTDTEGKPLGGAQLE 146 T S GP+Y LP D + NGG+ + +V G VTDT G P+ GA +E Sbjct: 23 TPSQTEGPYYPVALPADTDFDLLRNGGARYNEG----QAAWVEGSVTDTRGVPVAGAVVE 78 Query: 147 VWQCNSAGFYSQQAD--HDGPEFNLRGTFITDDEGNYSFECLRPTSYPIPYDGPAGDLLK 204 +WQC+ AG Y D P F G +G Y F LRP PY G Sbjct: 79 IWQCDQAGHYHHPGDGGRADPAFQGFGRVSVGRDGRYRFRTLRPA----PYSG------- 127 Query: 205 IMDRHPNRPSHIHWRVSHPGYHTLITQIYDAECPYTNNDSVY 246 R HIH +V L TQ+Y A P D ++ Sbjct: 128 -------RTPHIHVKVKLDRAELLTTQLYVAGDPGNERDFLW 162 Lambda K H 0.316 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 193 Length adjustment: 23 Effective length of query: 280 Effective length of database: 170 Effective search space: 47600 Effective search space used: 47600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory