Align arylformamidase (EC 3.5.1.9) (characterized)
to candidate WP_068166778.1 HTA01S_RS01485 alpha/beta hydrolase
Query= BRENDA::E1C2H6 (293 letters) >NCBI__GCF_001592305.1:WP_068166778.1 Length = 294 Score = 123 bits (309), Expect = 4e-33 Identities = 92/276 (33%), Positives = 140/276 (50%), Gaps = 30/276 (10%) Query: 34 HIDVTTAGTQKARAAAHTLLHVPYGDGEGEKLDIYFPAD---SSETFPVFVYIHGGYWQC 90 H + + + AR +L V YG G GE LD+ FPA ++ PV V+IHGGYW+ Sbjct: 28 HFERWASESLAARRQLGGMLDVAYGHGAGETLDL-FPAPRPHNAPPAPVLVFIHGGYWRS 86 Query: 91 LSKDASGFAAPALLSQGVAVVALGYDIAPRGHMDAMVLQVRRSLAFLVKQY-------HR 143 L K F APA + G VV Y + P + + LQ+ LA+L + HR Sbjct: 87 LDKADHSFVAPAFVKHGACVVVPNYALCPAVGIPDIALQMVDLLAWLYRNIAVHGGDPHR 146 Query: 144 IRGIYLCGHSAGAHLAAMVLSTDWTEFGV-VPD--IRGAVLVSGVYDLEPLLHT-YVNDA 199 I L GHSAG LAA++L+ W + G +PD ++ A+ +SG+YDLEPL HT ++ D+ Sbjct: 147 IT---LVGHSAGGQLAALLLACRWRDVGADLPDALVKNALSISGLYDLEPLRHTPFLRDS 203 Query: 200 LNMSLEVAQRNSPILCVTQAVPVAASCEVLVAV-AQHDSPEFRRQSQEYSQALRSAGWSV 258 L ++ ++ SP L PV +L V +S EF R ++ QA W Sbjct: 204 LRLTPAQVKKVSPAL--LPVPPVREGRGLLYTVTGGEESSEFLRHNRMIQQA-----WGE 256 Query: 259 SLLD----LASVDHFDIIEKLSEETYVLTQVILNMI 290 ++ L ++HF ++E L + + L Q+ L ++ Sbjct: 257 EVVPVCEALPGLNHFSVLEALVQPGHRLNQLALQLL 292 Lambda K H 0.321 0.133 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 294 Length adjustment: 26 Effective length of query: 267 Effective length of database: 268 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory