Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_068166972.1 HTA01S_RS02540 glyoxylate/hydroxypyruvate reductase A
Query= curated2:Q9YAW4 (335 letters) >NCBI__GCF_001592305.1:WP_068166972.1 Length = 308 Score = 97.4 bits (241), Expect = 4e-25 Identities = 80/265 (30%), Positives = 114/265 (43%), Gaps = 11/265 (4%) Query: 61 DLLSQAPRLRIVAQMAVGFDNIDVECATRLGIYVTNTPGVLTEATAEFTWALILAAARRV 120 DL ++ P L ++ G D D V + E+ +L+ R Sbjct: 51 DLATRFPNLEVLFSTGAGIDQFDFSVIPETLPVVRMVESGIVNGMVEYATLAVLSLHRDW 110 Query: 121 VEADHFVRWGEWWRLRTGWHPMMMLGVELRGKTLGILGMGRIGSRVAEIGKAFGMRIIYH 180 + G W R HP + +G+LG+G +G V E +FG Sbjct: 111 STYRQQQQEGRWEAHRV--HPA-------GSRRVGVLGLGVLGRAVLERLGSFGFPCAGW 161 Query: 181 SRSRKREIEKELGAEYRSLEDLLRESDILSIHLPLTDETRHLIGESELKLMKKTAILVNT 240 SRS+++ E A L L +DIL LPLTD TR ++ + + A L+N Sbjct: 162 SRSQQQIAGVECHAGAEGLTAFLARTDILICLLPLTDSTRGILCKPLFDQLPSGAALINV 221 Query: 241 GRGAIVDTGALVKALREGWIAAAALDVFEEEPLNPNHPLTAFKNVVLAPHAASATRETRL 300 GRGA + L++AL EG ++ A LDV E EPL P H VVL PH AS T+ Sbjct: 222 GRGAHLVQDDLLRALDEGQLSRAVLDVCEPEPLPPGHAFWTHPQVVLTPHIASMTQPETA 281 Query: 301 RMAMMAAENLVAFAQGKVPPNLVNR 325 A++ +NL QG LV+R Sbjct: 282 VDAVI--DNLRRHQQGLPMIGLVDR 304 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 308 Length adjustment: 28 Effective length of query: 307 Effective length of database: 280 Effective search space: 85960 Effective search space used: 85960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory