Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_068174208.1 HTA01S_RS18420 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_001592305.1:WP_068174208.1 Length = 331 Score = 243 bits (619), Expect = 6e-69 Identities = 135/312 (43%), Positives = 191/312 (61%), Gaps = 6/312 (1%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKEL 61 +P + I R + + + + +E+E + L+E+++ ++T ++++D L Sbjct: 4 RPAILIARAVFPEVVARLREHFEVETNEQDAPFTPAQLIERLQGKVGVMTTGSERIDAAL 63 Query: 62 LENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVE 121 L P+L++ A AVGY+N D+ T G+ TNTP VLT+ TAD FALL+A ARRI E Sbjct: 64 LAACPQLRVAANIAVGYNNFDVPAMTAAGVLATNTPDVLTETTADFGFALLMATARRICE 123 Query: 122 ADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKR-AKGFGMKIIYYS 180 ++ F+R+G+W + W MF G + G TLGI+G GRIGQA+A+R A GFGM +IY++ Sbjct: 124 SEHFLRAGQWNR----WALDMFAGAEVHGSTLGILGMGRIGQAIARRGAHGFGMNVIYHN 179 Query: 181 RTRKPEAEEEI-GAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINT 239 R+R E A YV LL+++D + L VP + E++H IG EL MKP A L+N Sbjct: 180 RSRLDTGSEAACRARYVSKAELLQQADHLVLVVPYSAESHHTIGAAELAQMKPTATLVNI 239 Query: 240 SRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREG 299 +RG +VD AL AL+E IA AGLDVFE EP + +L + NVVL PHI SAT R Sbjct: 240 ARGGIVDDAALAVALREKRIAAAGLDVFEGEPKVHPDLLTVPNVVLTPHIASATLPTRLA 299 Query: 300 MAELVAKNLIAF 311 MA L A NLIA+ Sbjct: 300 MANLAADNLIAY 311 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 331 Length adjustment: 28 Effective length of query: 303 Effective length of database: 303 Effective search space: 91809 Effective search space used: 91809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory