Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_068175438.1 HTA01S_RS22370 phosphoglycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_001592305.1:WP_068175438.1 Length = 420 Score = 167 bits (424), Expect = 3e-46 Identities = 103/298 (34%), Positives = 159/298 (53%), Gaps = 16/298 (5%) Query: 31 PKAPPRGVLLEKVREVDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRG 90 P A P LL K+ + + ++ ++L +A +L + + +G + +D+ A +RG Sbjct: 50 PGALPDDQLLAKIADAHFVGIRSRTQLTAKVLSHAQRLAAVGCFCIGTNQVDLAAARERG 109 Query: 91 IYVTNTPGVLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKG 150 I V N P T + A+L A + + R I E +A G W KS + ++G Sbjct: 110 IAVFNAPFSNTRSVAELVLAEAILLMRGIPEKNAVAHRGGWLKSASN-------SFEIRG 162 Query: 151 KTLGIVGFGRIGQALAKRAKGFGMKIIYYS-RTRKPEAEEEIGAEYVDFETLLKESDFIS 209 KTLGIVG+G IG L+ A+ GM ++++ T+ P + L+ +D +S Sbjct: 163 KTLGIVGYGAIGTQLSVLAEALGMHVVFFDVATKLPLGNAR---PLTSLDELMATADVVS 219 Query: 210 LHVPLTKETYHMIGEKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEE 269 LHVP T T MIG +L MKP+A+LIN SRG VV +AL AL + GA +DVF E Sbjct: 220 LHVPETPATQWMIGAAQLARMKPSAVLINASRGTVVQVDALASALHNQALLGAAIDVFPE 279 Query: 270 EPYYNEELFK-----LKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLVN 322 EP+ N+++F+ L NV+L PHIG +T EA+E + VA+ L+ ++ + VN Sbjct: 280 EPHSNKDVFESPLRGLDNVILTPHIGGSTLEAQENIGIEVAEKLVKYSDNGTSTSAVN 337 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 420 Length adjustment: 30 Effective length of query: 301 Effective length of database: 390 Effective search space: 117390 Effective search space used: 117390 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory