Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_077243674.1 B1A74_RS02500 phosphoglucosamine mutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_001995255.1:WP_077243674.1 Length = 446 Score = 219 bits (557), Expect = 2e-61 Identities = 154/450 (34%), Positives = 226/450 (50%), Gaps = 28/450 (6%) Query: 1 MGKLFGTFGVRGIANE-KITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKE 59 MG+ FGT G+RG E +TPEFA+++G A G +L G + V+VG+DTRVSG M + Sbjct: 1 MGRYFGTDGIRGRTGEWPMTPEFALRLGYAVGEILGENGYAQGPVLVGKDTRVSGYMFES 60 Query: 60 ALISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMG 119 AL +GL + G DV +G PTPA+ + T+ F A G VI+ASHNP NG K P G Sbjct: 61 ALEAGLSAAGLDVALLGPMPTPAIAYLTRTFRATAGVVISASHNPFNDNGFKFFTPEGDK 120 Query: 120 LKKEREAIVEELFFKEDFDRAKWYEIGE-VRREDIIKPYIEAIKSKVDVEAIKKRKPFVV 178 L EA +E E +G+ VR D Y+E KS + + + R +V Sbjct: 121 LPDAVEAAIEAR-LDEPAQAIDGRRLGKAVRISDAAGRYVEFCKSAIPARS-ELRGMRIV 178 Query: 179 VDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADF 238 +D ++GA P++ ELG +V A PDGY N + E V+A G+D Sbjct: 179 LDCAHGATYNVAPHVFEELGAEVELTGAMPDGY--NINEGVGALHPDRLAERVRATGSDL 236 Query: 239 GVAQDGDADRAVFIDENGRFIQGDKTFALVA--DAVLKEKGGGLLVTTVATSNLLDDIAK 296 G+A DGD DR + +D G+ + GD+ ++A L GGG++ T + L + +A+ Sbjct: 237 GIALDGDGDRVILVDAAGQIVDGDRILGILALERLHLGTLGGGVVGTQMTNLGLENALAE 296 Query: 297 KHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKS 356 G +R +VGD V L +GGE +G +I +H DG + ++ + +S Sbjct: 297 V-GVPFVRARVGDRYVLEELRRYGWLLGGESSGHIICLDHTTTGDGTVAGLQIAHLMQRS 355 Query: 357 GKKFSELIDELPKYYQ-IKTKRHVEG-----DRHAIVNKVAEMARERGYTVDTTDGAKII 410 G+ +EL +P++ Q + R EG D + VAE+ E G Sbjct: 356 GRSLAELAAAIPQFPQALVNVRLDEGADERLDAPPVRAAVAEVESELG------------ 403 Query: 411 FEDGWVLVRASGTEPIIRIFSEAKSKEKAQ 440 G VL+R SGTEP+IR+ EA+ Q Sbjct: 404 -RRGRVLLRPSGTEPLIRVMVEAEDAGATQ 432 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 21 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 446 Length adjustment: 33 Effective length of query: 422 Effective length of database: 413 Effective search space: 174286 Effective search space used: 174286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory