Align D-lactate oxidase, FAD-linked subunit (EC 1.1.3.15) (characterized)
to candidate WP_078429444.1 BK574_RS17260 FAD-linked oxidase C-terminal domain-containing protein
Query= reanno::Smeli:SMc00832 (479 letters) >NCBI__GCF_002019605.1:WP_078429444.1 Length = 455 Score = 202 bits (513), Expect = 3e-56 Identities = 139/460 (30%), Positives = 226/460 (49%), Gaps = 21/460 (4%) Query: 22 VADLADLLPEGGLISDERGLKPFETDAFIAYRRMPLAVVLPETTEHVAAVLKYCSRYGIP 81 + +L L+ + ++E L+ D +P V+ PE+ E V+ +L Y +++ IP Sbjct: 5 INELKKLISNERVTTNETMLEQHSRDESYHRPSLPDVVIFPESKEEVSKILAYANQHKIP 64 Query: 82 IVPRGAGTSLSGGAIPQEDAIVVGLSKMSRTLDIDLFNRTATVQAGVTNLNISDAVSADG 141 +VP G GTSL IP I + LS M++ ++I + V GVT ++ + G Sbjct: 65 VVPFGLGTSLEAHVIPYNGGISLDLSLMNQIVEIKEKDFLVKVGPGVTRTQLNKELKKYG 124 Query: 142 FFYAPDPSSQLACTIGGNIGMNSGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGG-KALD 200 F++ DP + T+GG N+ G +KYG+ + + +++VL +G +I GG A Sbjct: 125 LFFSVDPGAD--ATLGGMAATNASGTTSVKYGIMRDQVRDLEVVLANGDIIHTGGLAAKS 182 Query: 201 APGYDLLGLVCGSEGQLGIVTEATVRLIAKPEGARPVLFGFASSESAGSCVADIIGSGII 260 + GY L GL+ GSEG LG++TE T+++ PE F S ++A V I+ +GI Sbjct: 183 SSGYHLNGLMVGSEGTLGVITELTLKVYGIPEETMAARASFPSVDNAVDAVVSILSAGIP 242 Query: 261 PVAIEFMDRPAIEICEAFAQAGYPLDVEALLIVEVEGSEAEMDATLAGIIEIARRHGVMT 320 IE +D +I+ + Y + L +E G+EA + + EI G Sbjct: 243 IARIELVDARSIKQVNQQLKTTY--EESPTLFLEFHGNEAGLQQDVEFTKEIVHDLGCKD 300 Query: 321 IRESQSALEAALIWKGRKS---AF--GATGRIADYICMDGTVPLSQLSHVLRRTGEIVAG 375 I + +W+ R + AF G+ GR + D +VPLS+LS+ + + V Sbjct: 301 ILFEIDSKARHELWEARHNLAYAFIHGSPGR--KLMVTDVSVPLSELSNAIAHSRSEVDK 358 Query: 376 YGLRVANVFHAGDGNMHPLILYNINDPEEAARAEAAGNDILKLCVEAGGCLTGEHGVGIE 435 GL A H GDGN H L++ ++N+ EE A+ I++ + GG TGEHGVG+ Sbjct: 359 LGLDGAITGHVGDGNYHVLLMVDLNNEEEMKLAQKFNQTIVQYAISKGGTCTGEHGVGLG 418 Query: 436 KRDLMLHQYSRADLGQ----QMAARAAFDPQWLMNPSKVF 471 K +Y R + G A + + DP ++NP K+F Sbjct: 419 KA-----KYQRLEHGSSYEVMKAIKKSLDPNNILNPGKIF 453 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 455 Length adjustment: 33 Effective length of query: 446 Effective length of database: 422 Effective search space: 188212 Effective search space used: 188212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory