Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_078429421.1 BK574_RS17060 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_002019605.1:WP_078429421.1 Length = 351 Score = 228 bits (580), Expect = 3e-64 Identities = 130/299 (43%), Positives = 186/299 (62%), Gaps = 22/299 (7%) Query: 1 MGQIQLTDLTKRFGD--TVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSG 58 M IQ ++TK + T AVD L+L+I + E + L+GPSGCGK+TTLRMLAG E PT+G Sbjct: 1 MSFIQFDNVTKYYNRAATPAVDQLNLEILEGEIITLLGPSGCGKTTTLRMLAGFEQPTTG 60 Query: 59 DIYIGG----DHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDER 114 I IG D P+ R I MVFQDYAL+PH+T+ +N+ FGL + + ++ +R Sbjct: 61 KIRIGDEVVYDDRRALPPEKRGIGMVFQDYALFPHLTIEKNVTFGLNR---WKNRDKKKR 117 Query: 115 VVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMR 174 EV E +G+ + R P ELSGGQQQRVAL RA+ P+V LMDEP SNLDA LR +MR Sbjct: 118 AQEVLELVGLGEFGHRLPSELSGGQQQRVALARALAPRPKVILMDEPFSNLDAGLREKMR 177 Query: 175 TELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEF 234 ++ N+ + T + VTH+Q +A ++DR+ VM++G +QQ+A+P E Y P N FVA+F Sbjct: 178 YDVTNILRKANATAIIVTHDQKDAFAVSDRVVVMNEGIIQQIAAPKEMYRCPANCFVAQF 237 Query: 235 IGEPMINLVRGT-----RSESTFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVAD 288 +G+ NL+ GT + T +G + V+E+V ++ +RPE +A+ Sbjct: 238 VGK--TNLISGTLCPDLKHVETHIGRVCLPQETDKVIENV------MVSIRPEGCRLAE 288 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 351 Length adjustment: 30 Effective length of query: 353 Effective length of database: 321 Effective search space: 113313 Effective search space used: 113313 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory