Align 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase; 2-dehydro-3-deoxy-galactonate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase; EC 4.1.2.14; EC 4.1.2.51; EC 4.1.2.-; EC 4.1.2.21 (characterized)
to candidate WP_078428444.1 BK574_RS09525 4-hydroxy-tetrahydrodipicolinate synthase
Query= SwissProt::Q6KZI8 (266 letters) >NCBI__GCF_002019605.1:WP_078428444.1 Length = 296 Score = 115 bits (287), Expect = 1e-30 Identities = 73/263 (27%), Positives = 131/263 (49%), Gaps = 5/263 (1%) Query: 1 MITPLDAHGNIDYNATNILIKYLEGINVDYLFPMGSTGVFPYFTLKERKDFLKFVRE--N 58 M+TP D +GNID AT L+ +L D L G+TG P + +E+ K V E N Sbjct: 11 MVTPFDVYGNIDVQATEQLVNHLISNGTDGLVVAGTTGESPTLSTEEKLTLFKQVVEITN 70 Query: 59 SKKPIMAGVGSSSINEVNELMKFSMDIGIEAAVLMPPYYIKLNQEAIYHYYKEILSSNDM 118 + P++AG GS++ E EL K + +IG++ +L+ PYY K +QE ++ ++K I + Sbjct: 71 GRVPVIAGTGSNNTAESIELTKQAEEIGVDGIMLVAPYYNKPSQEGLFQHFKAIAEQTKL 130 Query: 119 DLLIYNIP-QFTNKIDPETVKNLKSEFSSVKGVKDSSADIRGFMEMLSLSDDDFAVFQGQ 177 ++IYNIP + I +T L S+ ++ K++S ++ +++S +D +F+++ G Sbjct: 131 PVMIYNIPGRSAVNISADTTIRL-SQVPNIVATKEASGNLEAMAKIISETDTNFSLYSGD 189 Query: 178 DDLLFTSLELGASGGVCGTTN-FSDGIVRLYHEYKNNREMALKIEKNDVIPLMKKLGKYQ 236 D L L +G +G V +++ + + + + + ++P+MK L Sbjct: 190 DSLTLPILSIGGTGIVSVSSHIIGNEMQSMVTSFLKGNIYEAAEQHRQLLPIMKALFTAP 249 Query: 237 FPNAYYEYFYKKNNINGGYRPPM 259 P K G R P+ Sbjct: 250 NPTPVKTALNMKGITVGSVRLPL 272 Lambda K H 0.319 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 296 Length adjustment: 26 Effective length of query: 240 Effective length of database: 270 Effective search space: 64800 Effective search space used: 64800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory