Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate WP_078430749.1 BK574_RS01735 ABC transporter permease
Query= TCDB::Q7BSH3 (333 letters) >NCBI__GCF_002019605.1:WP_078430749.1 Length = 321 Score = 148 bits (374), Expect = 2e-40 Identities = 90/287 (31%), Positives = 154/287 (53%), Gaps = 4/287 (1%) Query: 19 MIVVFSTRA-ADFATPGNLAGIFNDTSILIILALAQMTVILTKSIDLSVAANLAFTGMAI 77 +I++FS + + FA+ N I S L+I+AL V+ K DLS+ A + G+ Sbjct: 28 IIIIFSILSPSSFASFDNFINITRQISFLVIIALGATLVMAVKEFDLSIGAMASLGGVLS 87 Query: 78 AMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGTLTIYRGMAFVLS 137 A++ A+ P++ +L+ +++G +G NG +V ++ V TL T+ G+ F L+ Sbjct: 88 ALLAAS--GTPIIFCLLVPIIVGFVVGFFNGAIVTKFKVLSFVTTLAMGTVIGGVTFWLT 145 Query: 138 GGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLLRYTQFGRSAYATGGNPT 197 GGA V + F + ++ + LP LS + ++VI+ + ++ T GR YA GGN Sbjct: 146 GGATV-FENIPEGFKFLGQSKLAFLPTLSVIMFVLVIIFWYIMSQTSLGRRLYAIGGNEK 204 Query: 198 AAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIANGFELDSVAACVIGGIS 257 A+ +GI+ K +AF L G LA L SR A+ +GF L++ AA +G Sbjct: 205 ASEVSGINIARYKNIAFALCGMLAAFTGALLASRLGSAHPTGGDGFFLNAYAAVFLGMTI 264 Query: 258 IAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVIILAV 304 + GV ++ GT+ GA +G++ N L ++ + F Q I+G +II+A+ Sbjct: 265 VKNGVPNILGTLFGAAIIGIMANGLTILEVPSFIQNIITGAIIIIAL 311 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 321 Length adjustment: 28 Effective length of query: 305 Effective length of database: 293 Effective search space: 89365 Effective search space used: 89365 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory