Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_078429421.1 BK574_RS17060 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_002019605.1:WP_078429421.1 Length = 351 Score = 202 bits (513), Expect = 1e-56 Identities = 109/284 (38%), Positives = 172/284 (60%), Gaps = 9/284 (3%) Query: 8 NVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR 67 NV+K + + A+D +N+ I GE +LGPSG GKTT +R++AG + P+TG++ D Sbjct: 8 NVTKYYNRAATPAVDQLNLEILEGEIITLLGPSGCGKTTTLRMLAGFEQPTTGKIRIGDE 67 Query: 68 LVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKI 127 +V + + + PPE R IGMVFQ +AL+P+LT +N+ F L K + +KR +EV ++ Sbjct: 68 VVYDDRRAL-PPEKRGIGMVFQDYALFPHLTIEKNVTFGLNRWK--NRDKKKRAQEVLEL 124 Query: 128 LDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQ 187 + + + P ELSGGQQQRVALARAL P ++L+DEPFSNLDA +R+ R V + Sbjct: 125 VGLGEFGHRLPSELSGGQQQRVALARALAPRPKVILMDEPFSNLDAGLREKMRYDVTNIL 184 Query: 188 SRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINEL 247 + T ++V+HD D FA++DRV V+ +G + Q+ P+++Y P + VA +G+ N + Sbjct: 185 RKANATAIIVTHDQKDAFAVSDRVVVMNEGIIQQIAAPKEMYRCPANCFVAQFVGKTNLI 244 Query: 248 EGKVTNE----GVVIGSLRFPVSVSS--DRAIIGIRPEDVKLSK 285 G + + IG + P + ++ IRPE +L++ Sbjct: 245 SGTLCPDLKHVETHIGRVCLPQETDKVIENVMVSIRPEGCRLAE 288 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 351 Length adjustment: 29 Effective length of query: 324 Effective length of database: 322 Effective search space: 104328 Effective search space used: 104328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory