Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_078430036.1 BK574_RS21465 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_002019605.1:WP_078430036.1 Length = 320 Score = 219 bits (558), Expect = 7e-62 Identities = 136/310 (43%), Positives = 183/310 (59%), Gaps = 7/310 (2%) Query: 3 KIVAWKSLPEDVLAYLQQHAQV---VQVDATQHDAFVAALKDADGGIGSSV-KITPAMLE 58 K++ + LP + + L++ A V + + + A+ D D I V +I +++ Sbjct: 4 KVLVTRDLPGEGIERLREVADVEVHTGKEELTKEQLIQAIADKDAIISLLVNEIDAEVMD 63 Query: 59 GATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELA 118 A LK +S +VGF+ DV RGI++ NTPDVLTESTAD ++L+LA ARR+ E Sbjct: 64 AAPHLKVISNYAVGFNNIDVDAAQERGIIVTNTPDVLTESTADLTWALLLAVARRIPESD 123 Query: 119 EWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTN-RSANP 177 + + G + L G V GKTLGI+G+GRIG AV RRA GF M ++Y N R + Sbjct: 124 TYTREGKFVGWAPELLLGRTVYGKTLGIIGMGRIGEAVVRRAK-GFGMNIVYYNRRPLST 182 Query: 178 QAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATV 237 + E A L E+++ ADF+ L PLTPET++LI ELK+MK +A LIN SRG V Sbjct: 183 EKELELDASYASLEEVISQADFLSLHTPLTPETRYLIDENELKAMKDTAYLINTSRGPLV 242 Query: 238 DEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNA 297 +EKAL+ AL+ I GAGLDVFE EP + LL NVV PHIGSAT ETR MA A Sbjct: 243 NEKALVNALKEKAIAGAGLDVFENEP-AIEEELLNFQNVVLAPHIGSATIETRVEMADLA 301 Query: 298 AENLVAALDG 307 N ++ L G Sbjct: 302 INNTISILKG 311 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 320 Length adjustment: 28 Effective length of query: 293 Effective length of database: 292 Effective search space: 85556 Effective search space used: 85556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory