Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_078430830.1 BK574_RS10245 phosphoglycerate dehydrogenase
Query= BRENDA::O66939 (334 letters) >NCBI__GCF_002019605.1:WP_078430830.1 Length = 524 Score = 162 bits (410), Expect = 2e-44 Identities = 102/286 (35%), Positives = 159/286 (55%), Gaps = 18/286 (6%) Query: 37 ENELKKAELISVFVYDKLTEELLSKMPRLKLIHTRSVGFDHIDLDYCKKKGILVTHIPAY 96 + EL + I V +T EL+ KMP LK+I VG D+ID++ K GI+V + P Sbjct: 35 QQELHTFDAILVRSATTVTAELIEKMPNLKIIARAGVGVDNIDIEAATKAGIVVVNAPDG 94 Query: 97 SPESVAEHTFAMILTLVKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGRIGSRV 156 + S AEHTF+MI L +++ + +K +++ + EL TLG++G GRIGS++ Sbjct: 95 NTISTAEHTFSMICALARKIPQANQSIKLGEWNRKA-FQGTELRGKTLGIVGFGRIGSQL 153 Query: 157 AMYGLAFGMKVLCYDVVKREDLKEK-GCVYTSLDELLKESDVISLHVPYTKETHHMINEE 215 A AF M+ L +D + EK G V +L+E+L+++D+I++H P TK+T ++ E Sbjct: 154 AKRAKAFEMQPLVFDPFLTKARAEKLGVVPATLEEVLEKADIITVHTPLTKDTKGILGME 213 Query: 216 RISLMKDGVYLINTARGKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATD 275 I K GVYLIN ARG ++D AL + G +G LDVFE+E + Sbjct: 214 NIGKTKRGVYLINCARGGIIDEVALKHYLENGHVAGAALDVFEEEPAI------------ 261 Query: 276 KNLKILELACKDNVIITPHIAYYTDKSLERIREETVKVVKAFVKGD 321 + ++EL DNVI TPHIA T ++ + + + V F++G+ Sbjct: 262 -DNALIEL---DNVIATPHIAASTKEAQLNVAAQVSEEVLLFLEGN 303 Lambda K H 0.319 0.138 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 524 Length adjustment: 32 Effective length of query: 302 Effective length of database: 492 Effective search space: 148584 Effective search space used: 148584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory