Protein WP_085769830.1 in Methylocystis bryophila S285
Annotation: NCBI__GCF_002117405.1:WP_085769830.1
Length: 370 amino acids
Source: GCF_002117405.1 in NCBI
Candidate for 19 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| trehalose catabolism | malK | lo | MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) | 32% | 90% | 150.2 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 41% | 58% | 147.5 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 39% | 55% | 147.1 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 40% | 53% | 147.1 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 40% | 53% | 147.1 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 31% | 88% | 144.4 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 36% | 58% | 143.7 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 41% | 57% | 143.3 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 34% | 64% | 142.1 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | malK | lo | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 41% | 51% | 141 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-cellobiose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-glucose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| lactose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| sucrose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| trehalose catabolism | gtsD | lo | GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) | 32% | 82% | 137.9 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 31% | 81% | 137.5 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| lactose catabolism | lacK | lo | LacK, component of Lactose porter (characterized) | 40% | 53% | 136 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
| D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 36% | 58% | 132.5 | ABC-type molybdate transporter (EC 7.3.2.5) | 40% | 239.2 |
Sequence Analysis Tools
View WP_085769830.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSAGHTIRAEFRNALGKFTLDAAFETPAKGVTALFGPSGCGKTTVIRCVAGLTRVKDGYC
RIDGEIWQDRDGVFLPTHKRPLGYVFQEASLFPHLSVRRNLLFGAPKEKSKDRPQIDFDE
VVDLLGLRRLLERSPTNLSGGERQRVGIGRALLTQPKLLLMDEPLSALDRKTKNEILPFI
EKLRDHFAVPIFYITHDITEVERLADQVVLLEKGHVVMAGPLAELQSNPDSPLASSREAA
VSLRGSVVSFDPHYGLLNLSIPGGLLIAPSPPAEIGETRRIRILASDVSLACESPGPSSI
LNVLPAKVVTMKPLDPYETLVVLALGEKGEGARLLARMSRKSCETLGLSKNLSVFAQVKY
VALAAGGDED
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory