GapMind for catabolism of small carbon sources

 

Protein WP_085769830.1 in Methylocystis bryophila S285

Annotation: NCBI__GCF_002117405.1:WP_085769830.1

Length: 370 amino acids

Source: GCF_002117405.1 in NCBI

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 32% 90% 150.2 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 58% 147.5 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 55% 147.1 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 53% 147.1 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 53% 147.1 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 31% 88% 144.4 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 36% 58% 143.7 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 41% 57% 143.3 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 64% 142.1 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 41% 51% 141 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-cellobiose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-glucose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
lactose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
sucrose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
trehalose catabolism gtsD lo GtsD (GLcK), component of Glucose porter, GtsABCD (characterized) 32% 82% 137.9 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 31% 81% 137.5 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 40% 53% 136 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 36% 58% 132.5 ABC-type molybdate transporter (EC 7.3.2.5) 40% 239.2

Sequence Analysis Tools

View WP_085769830.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSAGHTIRAEFRNALGKFTLDAAFETPAKGVTALFGPSGCGKTTVIRCVAGLTRVKDGYC
RIDGEIWQDRDGVFLPTHKRPLGYVFQEASLFPHLSVRRNLLFGAPKEKSKDRPQIDFDE
VVDLLGLRRLLERSPTNLSGGERQRVGIGRALLTQPKLLLMDEPLSALDRKTKNEILPFI
EKLRDHFAVPIFYITHDITEVERLADQVVLLEKGHVVMAGPLAELQSNPDSPLASSREAA
VSLRGSVVSFDPHYGLLNLSIPGGLLIAPSPPAEIGETRRIRILASDVSLACESPGPSSI
LNVLPAKVVTMKPLDPYETLVVLALGEKGEGARLLARMSRKSCETLGLSKNLSVFAQVKY
VALAAGGDED

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory