Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_085771912.1 B1812_RS12645 LPS export ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_002117405.1:WP_085771912.1 Length = 288 Score = 127 bits (320), Expect = 2e-34 Identities = 78/248 (31%), Positives = 124/248 (50%), Gaps = 13/248 (5%) Query: 2 GILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVM 61 G+L + N+ K + + + DV+L VR ++GPNGAGK+T+ + G + PD+G + Sbjct: 50 GVLAIHNLAKSYKTRRVVEDVSLHVRRGEAVGLLGPNGAGKTTVFYMITGLVKPDSGRIT 109 Query: 62 FDGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSG 121 DG V Y ++GI + Q +F L+V EN++ E+ Sbjct: 110 LDGYDVTPLPMYRRARLGIGYLPQEMSVFRGLTVEENIL--------AVLEI----VEPD 157 Query: 122 QRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMAR 181 ++ E+ + +LEE +A R A ++S G++RR EI ++ P +LLDEP AG+ Sbjct: 158 KKKRAEQLDGLLEEFRLAHLRKTPAIAVSGGERRRCEIARAIAGRPSFMLLDEPFAGIDP 217 Query: 182 ADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPK 241 DL++ +K +R I + I +H + L DR ++ G L E P I NP Sbjct: 218 IAIGGIQDLVRHLK-QRGIGVLITDHSVRETLGLTDRAYIIYNGHVLTEGAPAEIVANPD 276 Query: 242 VREAYLGE 249 VR YLGE Sbjct: 277 VRRIYLGE 284 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 288 Length adjustment: 25 Effective length of query: 226 Effective length of database: 263 Effective search space: 59438 Effective search space used: 59438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory