Align AapJ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_085770149.1 B1812_RS02245 transporter substrate-binding domain-containing protein
Query= TCDB::Q52812 (341 letters) >NCBI__GCF_002117405.1:WP_085770149.1 Length = 335 Score = 171 bits (434), Expect = 2e-47 Identities = 116/343 (33%), Positives = 165/343 (48%), Gaps = 10/343 (2%) Query: 1 MKNKLLSAAIGAAVLAVGASAASATTLSDVKAKGFVQCGVNTGLTGFAAPDASGNWAGFD 60 M LLS + + + G A A TL +++ ++CGV TG+ + D GN + + Sbjct: 1 MPRLLLSLLVTGLLASCGV--AHAQTLESIRSAKHMECGVVTGVDDWNGEDLHGNLSALE 58 Query: 61 VDFCKAVASAVFGDPTKVKYTPTNAK-ERFTALQSGEIDVLSRNTTWTINRDTALGFNFR 119 + C+AVA A+ GD + V A+ E AL++G+I L+ T + + G F Sbjct: 59 AEVCRAVAVALLGDASAVTIQNFPAELEALNALKAGKIQ-LAIGVTPSASTAARFGVGFG 117 Query: 120 PVTYYDGQGFMVRKGLNVKSALELSGAAICVQSGTTTELNLADYFKTNNLQYNPVVFENL 179 P +YD Q MV KG V L +C T E L + + Y + Sbjct: 118 PPVFYDSQRLMVAKGSGVTDIAGLRDKLVCALDMTPPERILREELTARGIPYGLMAHSEQ 177 Query: 180 PEVNAAYDAGRCDVYTTDQSGLYSLRLTLKNPDEHI-ILPEIISKEPLGPAVRQGDDQWF 238 E++AA RC+ T +S L R P + LPE P+ PA R GD + Sbjct: 178 GEMDAAVAVSRCEAATAMESRLAQSRAGFHAPTSNFSFLPERFGINPVVPAYRYGDQIFG 237 Query: 239 DIVSWTAYALINAEEFGITQANVDEMKNSPNPDIKRFLGSETDTKIGTDLGLTNDWAANV 298 V WT ALI AE GIT+ NV K + ++ LG + T LGL +DWAA V Sbjct: 238 LTVDWTIGALIEAEALGITRDNVAASKRE-DLRAEQLLGRDFAT--AQALGLAHDWAAKV 294 Query: 299 IKGVGNYGEIFERNIGQGSPLKIARGLNALWNKGGIQYAPPVR 341 I GNYGEIF+R + G P + RGLNALW +GG+ + PP++ Sbjct: 295 IAATGNYGEIFQRTV--GGPYHLDRGLNALWTEGGLMHPPPMK 335 Lambda K H 0.316 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 335 Length adjustment: 28 Effective length of query: 313 Effective length of database: 307 Effective search space: 96091 Effective search space used: 96091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory