Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_085771912.1 B1812_RS12645 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_002117405.1:WP_085771912.1 Length = 288 Score = 133 bits (335), Expect = 4e-36 Identities = 79/259 (30%), Positives = 132/259 (50%), Gaps = 15/259 (5%) Query: 8 AENLGSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNF 67 AE + +L L+KS+ R V+ + V+ G GL+GPNGAGKTT+F +++ Sbjct: 41 AEGSQNDSEGVLAIHNLAKSYKTRRVVEDVSLHVRRGEAVGLLGPNGAGKTTVFYMITGL 100 Query: 68 IRPDQGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFL 127 ++PD G + +G + L ++ A G Q V LTV EN+L Sbjct: 101 VKPDSGRITLDGYDVTPLPMYRRARLGIGYLPQEMSVFRGLTVEENILAV---------- 150 Query: 128 PRLINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKL 187 V+ +++ E+ +LE L + A A+SGG+R+ E+ARA+ P Sbjct: 151 -----LEIVEPDKKKRAEQLDGLLEEFRLAHLRKTPAIAVSGGERRRCEIARAIAGRPSF 205 Query: 188 ILLDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLAD 247 +LLDEP AG++P IG I + + + ++GI L+ +H++ + L +++ G L + Sbjct: 206 MLLDEPFAGIDPIAIGGIQDLVRHLKQRGIGVLITDHSVRETLGLTDRAYIIYNGHVLTE 265 Query: 248 GTPEQIQSDPRVLEAYLGD 266 G P +I ++P V YLG+ Sbjct: 266 GAPAEIVANPDVRRIYLGE 284 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 288 Length adjustment: 25 Effective length of query: 242 Effective length of database: 263 Effective search space: 63646 Effective search space used: 63646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory